AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202503 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2079 POS_TIME 2742 POS_VISITOR 7698 POS_DAY 8222 POS_DOMAIN 3429 POS_LOGIN 3728 POS_ROBOT 3883 POS_WORMS 4220 POS_EMAILSENDER 4351 POS_EMAILRECEIVER 4494 POS_SESSION 8610 POS_FILESIZE 8831 POS_SIDER 8756 POS_FILETYPES 4629 POS_DOWNLOADS 4729 POS_OS 5569 POS_BROWSER 5721 POS_SCREENSIZE 5929 POS_UNKNOWNREFERER 6003 POS_UNKNOWNREFERERBROWSER 6343 POS_ORIGIN 6425 POS_SEREFERRALS 6556 POS_PAGEREFS 6700 POS_SEARCHWORDS 6848 POS_KEYWORDS 7000 POS_MISC 2405 POS_ERRORS 7059 POS_CLUSTER 3584 POS_SIDER_404 7193 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250401003520 8 1452 15377855338103 FirstTime 0 LastTime 20250317080259 LastUpdate 20250401184139 8 0 7 0 0 TotalVisits 1 TotalUnique 1 MonthHostsKnown 0 MonthHostsUnknown 17 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 AddToFavourites 0 14 0 FlashSupport 0 0 0 PDFSupport 0 0 0 QuickTimeSupport 0 0 0 DirectorSupport 0 0 0 JavascriptDisabled 0 0 0 RealPlayerSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 TotalMisc 0 0 0 JavaEnabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 2 7 42730 1 0 0 0 6 10 412038 2 0 0 0 4 22 1247195 3 0 0 0 7 17 209304 4 0 0 0 6 12 411888 5 0 0 0 6 14 118287 6 0 3 1041831 4 6 246 7 0 0 0 91 110 2359543 8 2 2 87156 131 131 275169 9 0 1 897689 6 20 251145 10 0 2 234210 16 21 881119 11 0 4 1923075 135 147 840385 12 0 1 65253 6 14 108603 13 0 1 62444 78 80 193407 14 0 0 0 2 7 1795604 15 0 10 2443383 10 21 109593 16 0 2 448691 4 11 2776923 17 0 0 0 0 3 166531 18 0 0 0 9 11 77528 19 0 0 0 12 23 964559 20 0 6 1246231 4 6 246 21 0 1 897689 10 27 324603 22 0 0 0 4 13 417873 23 0 1 168957 8 10 140944 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 6 jp 2 4 1882534 cn 0 1 897689 nl 0 6 1246231 za 0 1 897689 in 0 5 748154 us 0 17 3844312 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 5 Googlebot/ 76 912405 20250331215344 58 bingbot/ 29 495094 20250328074911 16 facebookexternalhit/ 26 5389090 20250330035920 20 bot[\s_+:,\.\;\/\\-] 25 3242509 20250327023441 6 crawl 4 2912 20250313104750 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 pdf 32 9429453 0 0 html 2 87156 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 12 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 16 0 14363024 /wp-content/uploads/2024/01/Academic-Calender-2018-19.pdf 9 0 587277 /wp-content/uploads/2024/01/Academic-Calender-2021-22.pdf 7 0 504497 /wp-content/uploads/2024/01/Tejasvi-Bhandari-madam-FACULTY-PROFILE.pdf 6 0 997710 /wp-content/uploads/2024/01/Academic-Calender-2020-21.pdf 6 0 374664 /wp-content/uploads/2024/01/Faculty-Profile.pdf 5 0 210075 /wp-content/uploads/2024/01/Academic-Calender-2022-23.pdf 4 0 309524 /wp-content/uploads/2024/01/Academic-Calender-2019-20.pdf 4 0 285572 /wp-content/uploads/2024/02/Marathi-Dr-Dipti-Shembekar-FACULTY-PROFILE.pdf 4 0 675828 /wp-content/uploads/2024/01/Kadam-P.A.pdf 2 0 564812 /wp-content/uploads/2024/01/Department-of-English-CO.pdf 1 0 402167 /sitemap.xml.gz 1 0 247 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 6 android10 2 0 ios_iphone 6 2 Unknown 3 0 android 6 0 androidmarshmallow 7 0 win10 10 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 8 chrome132.0.6834.79 1 0 chrome131.0.0.0 6 0 safari13.0.3 5 2 chrome134.0.6998.165 3 0 chrome133.0.6943.53 7 0 firefox132.0 6 0 safari 1 0 chrome134.0.0.0 5 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/133.0.6943.53_Safari/537.36 20250306152451 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/134.0.6998.165_Safari/537.36 20250330060658 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 2 29 From1 0 0 From2 0 0 From3 0 0 From4 0 5 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 409 3 249 301 188 0 302 12 0 404 79 4018342 406 287 64862 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 11 /wp-admin.php 1 - /sitemap_index.xml 4 - /_all_dbs 32 - /ads.txt 6 - /.git/config 14 - /sitemap.txt 4 - /_profiler/phpinfo 2 - /sitemap 8 - /phpinfo.php 2 - /sitemaps.xml 4 - /sitemap.xml.gz 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 17 43.159.152.4 2 2 87156 20250317080259 49.51.73.183 0 1 897689 204.137.14.71 0 7 2143920 196.251.73.223 0 1 897689 66.249.79.163 0 3 293845 103.226.143.166 0 1 65253 43.166.247.82 0 1 897689 49.32.168.74 0 1 168957 66.249.79.102 0 1 72071 5.255.115.202 0 6 1246231 66.249.79.37 0 1 65253 103.171.77.242 0 3 513944 66.249.68.6 0 1 65253 66.249.79.206 0 1 168957 43.166.246.180 0 1 897689 66.249.79.100 0 2 969760 66.249.79.162 0 1 65253 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 15 20250302 0 2 127697 0 20250303 0 3 296654 0 20250304 0 1 168957 0 20250306 0 1 65253 0 20250308 0 1 897689 0 20250311 0 1 897689 0 20250315 0 3 1346380 0 20250316 0 1 897689 0 20250317 2 2 87156 1 20250320 0 1 897689 0 20250323 0 1 168957 0 20250324 0 6 1246231 0 20250325 0 1 65253 0 20250327 0 6 1246231 0 20250330 0 4 1107084 0 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 1 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 2 87156 1 1 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 6 44-100 3 5K+ 149 2K-5K 1 500-1K 4 0-44 224 100-500 396 END_FILESIZE