AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202404 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2700 POS_VISITOR 6273 POS_DAY 6450 POS_DOMAIN 3220 POS_LOGIN 3461 POS_ROBOT 3616 POS_WORMS 3826 POS_EMAILSENDER 3957 POS_EMAILRECEIVER 4100 POS_SESSION 6552 POS_SIDER 6708 POS_FILETYPES 4235 POS_DOWNLOADS 4335 POS_OS 4507 POS_BROWSER 4596 POS_SCREENSIZE 4680 POS_UNKNOWNREFERER 4754 POS_UNKNOWNREFERERBROWSER 4881 POS_ORIGIN 5003 POS_SEREFERRALS 5135 POS_PAGEREFS 5279 POS_SEARCHWORDS 5427 POS_KEYWORDS 5579 POS_MISC 2364 POS_ERRORS 5638 POS_CLUSTER 3317 POS_SIDER_404 5759 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240501194342 1 0 14564550976309 FirstTime 0 LastTime 20240405220642 LastUpdate 20240502181749 1 0 0 0 0 TotalVisits 2 TotalUnique 2 MonthHostsKnown 0 MonthHostsUnknown 3 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 FlashSupport 0 0 0 RealPlayerSupport 0 0 0 TotalMisc 0 0 0 DirectorSupport 0 0 0 JavaEnabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 AddToFavourites 0 2 0 JavascriptDisabled 0 0 0 PDFSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 4 6 36952 1 0 0 0 1 1 226 2 0 0 0 2 2 0 3 0 0 0 33 37 262710 4 0 0 0 2 5 1832257 5 0 0 0 2 3 1364622 6 0 0 0 7 7 226 7 0 0 0 2 2 0 8 0 0 0 0 0 0 9 0 0 0 2 2 0 10 0 0 0 2 2 0 11 0 0 0 2 2 0 12 0 0 0 4 4 0 13 0 1 1364622 0 0 0 14 0 0 0 0 0 0 15 0 0 0 2 2 0 16 0 0 0 6 6 36952 17 0 0 0 0 0 0 18 0 0 0 2 2 0 19 0 0 0 0 0 0 20 0 0 0 6 6 0 21 0 0 0 2 2 0 22 53 53 76823 4 4 0 23 0 0 0 4 4 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 2 us 53 53 76823 in 0 1 1364622 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 bingbot/ 4 3196879 20240429053340 2 Go\-http\-client/ 2 1490 20240417034122 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 html 53 76823 0 0 pdf 1 1364622 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 2 /wp-content/uploads/2024/02/B.Ed-Syllabus-2017-18.pdf 2 0 2729244 /wp-content/uploads/2024/02/migrationform.pdf 1 0 1832037 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 2 win10 1 0 Unknown 53 53 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 2 Unknown 53 53 chrome109.0.0.0 1 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 1 Jetpack_by_WordPress.com 20240405220642 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Jetpack_by_WordPress.com 20240405220642 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 0 From1 0 0 From2 0 0 From3 0 0 From4 53 54 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 301 64 0 409 1 1200 406 8 1808 404 18 332568 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 10 /.git/HEAD 2 - /backup.zip 1 - /config.yml 4 - /.env.production 2 - /static/admin/javascript/hetong.js 1 - /Public/home/js/check.js 1 - /.git/config 2 - /config.xml 2 - /config.php 2 - /backup.tar.gz 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 3 192.0.86.184 44 44 62565 20240405220642 192.0.86.84 9 9 14258 20240405220601 103.176.135.72 0 1 1364622 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 2 20240405 53 53 76823 2 20240425 0 1 1364622 0 END_DAY # Session range - Number of visits BEGIN_SESSION 2 30s-2mn 1 0s-30s 1 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 53 76823 2 2 END_SIDER