AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202404 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2048 POS_TIME 2727 POS_VISITOR 8920 POS_DAY 10816 POS_DOMAIN 3369 POS_LOGIN 3761 POS_ROBOT 3916 POS_WORMS 4267 POS_EMAILSENDER 4398 POS_EMAILRECEIVER 4541 POS_SESSION 11290 POS_SIDER 11449 POS_FILETYPES 4676 POS_DOWNLOADS 4830 POS_OS 4878 POS_BROWSER 5159 POS_SCREENSIZE 5746 POS_UNKNOWNREFERER 5820 POS_UNKNOWNREFERERBROWSER 6438 POS_ORIGIN 6864 POS_SEREFERRALS 6999 POS_PAGEREFS 7143 POS_SEARCHWORDS 7291 POS_KEYWORDS 7443 POS_MISC 2391 POS_ERRORS 7502 POS_CLUSTER 3617 POS_SIDER_404 7604 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240501151350 52 11664 13597142030849 FirstTime 20240401104647 LastTime 20240430220714 LastUpdate 20240501182838 52 0 51 0 0 TotalVisits 49 TotalUnique 43 MonthHostsKnown 0 MonthHostsUnknown 48 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 JavaEnabled 0 0 0 JavascriptDisabled 0 0 0 TotalMisc 0 0 0 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 FlashSupport 0 0 0 AddToFavourites 0 0 0 PDFSupport 0 0 0 DirectorSupport 0 0 0 RealPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 2 2 98294 1 1 226 1 0 0 0 2 4 315 2 10 22 1078180 2 2 452 3 17 17 505000 87 93 405260 4 0 0 0 1 1 226 5 4 6 128479 4 6 56894 6 12 12 238074 0 0 0 7 4 4 196588 4 6 28271 8 0 0 0 2 2 98294 9 0 0 0 4 12 31536 10 10 31 24615066 0 10 3580 11 6 14 269490 0 2 0 12 4 4 55912 0 0 0 13 6 6 224544 0 0 0 14 4 10 168967 0 0 0 15 7 9 86097 0 0 0 16 13 13 308412 8 9 30595 17 2 3 28447 4 5 126741 18 4 4 126250 0 0 0 19 0 0 0 21 25 8021 20 2 2 27956 2 4 98294 21 4 4 55912 0 4 1432 22 12 18 246567 1 1 226 23 0 0 0 4 4 196588 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 13 us 66 107 26768984 ca 20 32 1068374 ru 9 9 83868 be 4 8 60370 gb 4 4 55912 cn 4 5 126741 br 4 4 55912 cz 2 2 27956 nl 2 2 27956 az 2 2 27956 jp 2 2 27956 vn 2 2 27956 au 2 2 98294 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 5 no_user_agent 14 688058 20240430033058 0 scanner 12 113788 20240430171302 0 Go\-http\-client/ 10 85300 20240430033114 0 (firefox/)([0-9]\.|[0-1][0]\.) 4 126250 20240430093803 0 archive\.org_bot 2 27956 20240430075349 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 5 png 8 7669 0 0 html 123 3120234 0 0 css 9 133023 0 0 js 36 1038930 0 0 jpg 5 24158379 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 17 winxp 1 0 bsdopenbsd 2 0 macosx 8 2 linux 23 8 androidmarshmallow 4 4 winlong 1 0 win2003 1 0 android10 4 4 win8 1 0 win7 8 6 macosx9 1 0 android 4 4 Unknown 32 26 win10 56 44 macosx13 1 0 win8.1 1 0 macosx15 33 25 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 27 chrome122.0.0.0 4 4 chrome117.0.0.0 20 14 chrome103.0.5060.114 4 4 chrome79.0.3945.130 2 2 Unknown 20 20 chrome41.0.2226.0 1 0 chrome36.0.1985.125 2 0 chrome96.0.4664.110 6 4 chrome116.0.0.0 6 6 chrome110.0.0.0 4 4 opera11.51 1 0 chrome52.0.3624.98 4 4 mozilla 14 6 firefox31.0 2 2 chrome121.0.0.0 44 18 chrome87.0.4280.88 8 2 firefox60.0 1 0 chrome35.0.1916.47 1 0 chrome71.0.2623.112 2 2 opera11.01 2 0 opera85.0.4341.75 2 2 firefox25.0 2 2 opera11.50 1 0 chrome108.0.0.0 9 9 chrome100.0.4896.60 16 16 firefox97.0 2 2 firefox26.0 1 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 4 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240421000828 colly_-_https://github.com/gocolly/colly/v2 20240430160703 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20240402111558 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20240425155409 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 2 colly_-_https://github.com/gocolly/colly/v2 20240430160703 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240421000828 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 123 161 From1 0 0 From2 0 0 From3 0 0 From4 0 20 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 2 406 17 3842 404 120 41757 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 38 /config.yml 6 - /robots.txt 2 - /wp-admin/setup-config.php 2 - /_all_dbs 4 - /___proxy_subdomain_webmail/ 3 - /vendor/swiper/swiper-bundle.min.js 2 - /vendor/bootstrap/js/bootstrap.bundle.min.js 2 - / 3 - /appointment.php 2 - /vendor/php-email-form/validate.js 2 - /feed 4 - /backup.tar.gz 4 - //ajax.googleapis.com/ajax/libs/jquery/3.6.3/jquery.min.js 2 - /.vscode/sftp.json 2 - /debug/default/view 4 - //maxcdn.bootstrapcdn.com/bootstrap/3.4.1/js/bootstrap.min.js 2 - /server 4 - /config.xml 4 - /.DS_Store 4 - /vendor/glightbox/js/glightbox.min.js 2 - /telescope/requests 4 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 4 - /.env.production 4 - /Public/home/js/check.js 2 - /config.yaml 2 - /v2/_catalog 4 - /vendor/purecounter/purecounter_vanilla.js 2 - /backup.zip 2 - /js/main.js 2 - /.git/HEAD 4 - /login.action 4 - /s/730323e2834323e20313e2631323/_/ 4 - /.git/config 8 - /config.php 4 - /.git/ 2 - /static/admin/javascript/hetong.js 2 - /config.json 2 - /about 4 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 48 35.171.144.152 10 10 491470 20240425030857 195.211.77.142 7 7 83868 20240430160703 104.164.173.53 7 13 176677 20240430220714 54.88.179.33 6 6 294882 20240426023924 154.28.229.130 6 6 83868 20240430062748 154.28.229.49 5 5 69890 20240430220713 3.75.89.197 4 16 783298 20240423020040 47.242.224.70 4 16 282022 20240430142837 189.38.205.214 4 4 55912 20240430160704 47.88.6.178 4 4 55912 20240430215750 198.235.24.254 2 2 98294 20240409072634 51.15.66.158 2 2 27956 20240430033151 139.59.132.8 2 2 98294 20240430033100 195.211.77.140 2 2 0 20240430160647 165.227.40.232 2 2 27956 20240429121511 198.235.24.87 2 2 98294 20240413185256 147.182.182.240 2 2 27956 20240424160238 36.99.136.128 2 2 27956 20240429172046 87.236.176.11 2 2 27956 20240418055505 198.235.24.8 2 2 98294 20240407021033 146.70.116.172 2 2 27956 20240430033232 198.235.24.217 2 2 98294 20240417061616 157.245.240.47 2 2 27956 20240430123335 52.87.44.246 2 16 24319358 20240403104343 143.244.168.161 2 2 98294 20240430033103 87.236.176.158 0 1 1738 36.99.136.129 0 1 491 109.205.213.18 2 2 27956 20240401104647 74.80.182.88 2 9 141502 20240402105656 171.244.43.14 2 2 27956 20240430183651 198.235.24.246 2 2 98294 20240403115509 205.210.31.252 2 2 98294 20240409052519 133.242.174.119 2 2 27956 20240430063440 154.28.229.228 2 2 27956 20240430062742 115.231.78.4 2 2 98294 20240412100043 198.54.132.241 2 2 27956 20240424133510 198.235.24.90 2 2 98294 20240405070402 178.249.209.174 2 2 27956 20240430033213 87.236.176.36 2 2 27956 20240425155402 104.248.202.39 2 2 27956 20240415202339 24.199.84.25 2 2 27956 20240401145317 205.210.31.27 2 2 98294 20240421000828 165.232.104.191 2 2 27956 20240410151744 87.236.176.154 0 1 1738 87.236.176.48 0 1 491 62.197.150.19 2 2 27956 20240402105642 87.236.176.118 0 1 491 199.45.155.38 2 4 30185 20240402111551 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 19 20240401 4 4 55912 2 20240402 6 15 199643 3 20240403 4 18 24417652 2 20240405 2 2 98294 1 20240407 2 2 98294 1 20240409 4 4 196588 2 20240410 2 2 27956 1 20240412 2 2 98294 1 20240413 6 6 294882 2 20240415 2 2 27956 1 20240417 2 2 98294 1 20240418 6 8 226773 2 20240421 2 2 98294 1 20240423 4 16 783298 1 20240424 4 4 55912 2 20240425 6 8 226773 3 20240426 4 4 196588 1 20240429 4 5 56403 2 20240430 57 75 1200429 20 END_DAY # Session range - Number of visits BEGIN_SESSION 2 15mn-30mn 1 0s-30s 48 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 3 / 119 3098546 49 48 /about.html 2 11488 0 1 /vision_mission.html 2 10200 0 0 END_SIDER