AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202404 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2691 POS_VISITOR 7843 POS_DAY 8304 POS_DOMAIN 3363 POS_LOGIN 3631 POS_ROBOT 3786 POS_WORMS 4152 POS_EMAILSENDER 4283 POS_EMAILRECEIVER 4426 POS_SESSION 8625 POS_SIDER 8762 POS_FILETYPES 4561 POS_DOWNLOADS 4694 POS_OS 5562 POS_BROWSER 5687 POS_SCREENSIZE 5854 POS_UNKNOWNREFERER 5928 POS_UNKNOWNREFERERBROWSER 6176 POS_ORIGIN 6293 POS_SEREFERRALS 6425 POS_PAGEREFS 6588 POS_SEARCHWORDS 6736 POS_KEYWORDS 6888 POS_MISC 2354 POS_ERRORS 6947 POS_CLUSTER 3487 POS_SIDER_404 7069 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240501043922 1 0 8835799890500 FirstTime 0 LastTime 0 LastUpdate 20240501182843 1 0 0 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 15 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 FlashSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 TotalMisc 0 0 0 PDFSupport 0 0 0 DirectorSupport 0 0 0 JavascriptDisabled 0 0 0 RealPlayerSupport 0 0 0 AddToFavourites 0 16 0 JavaEnabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 37 38 943649 1 0 0 0 7 11 149246 2 0 0 0 37 39 1044150 3 0 0 0 46 52 1207248 4 0 0 0 2 2 0 5 0 0 0 50 54 1209527 6 0 4 1108907 0 2 246 7 0 0 0 2 6 62916 8 0 0 0 8 12 3655714 9 0 2 86080 2 2 87658 10 0 1 12929 8 10 246 11 0 1 12929 4 4 82168 12 0 5 1417678 12 14 87404 13 0 2 1795378 10 15 123135 14 0 3 220605 8 17 368613 15 0 1 630345 4 5 711979 16 0 3 632657 6 11 153807 17 0 1 12929 2 4 1528034 18 0 6 1323575 6 10 81754 19 0 1 65253 12 12 0 20 0 1 72071 38 48 1037142 21 0 0 0 6 10 231784 22 0 0 0 8 16 250658 23 0 1 72071 2 4 82168 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 4 za 0 1 72071 in 0 21 4530991 jp 0 2 85055 us 0 8 2774265 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 6 bingbot/ 34 929946 20240429124712 20 Go\-http\-client/ 20 6540 20240429003703 0 Googlebot/ 20 1385031 20240423070716 12 facebookexternalhit/ 4 3590756 20240401085104 0 unknown 2 246 20240412103523 2 Dalvik/ 2 1260690 20240418170246 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 4 jpg 3 38787 0 0 pdf 21 6849646 0 0 png 6 522301 0 0 jpeg 2 51648 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 12 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 9 0 8079201 /wp-content/uploads/2024/01/Academic-Calender-2019-20.pdf 9 0 642537 /wp-content/uploads/2023/09/Faculty-S-Kurane-updated.pdf 5 0 3151725 /wp-content/uploads/2024/01/Academic-Calender-2021-22.pdf 4 0 288284 /wp-content/uploads/2024/01/Academic-Calender-2018-19.pdf 3 0 195759 /wp-content/uploads/2024/01/Faculty-Profile.pdf 3 1 127070 /wp-content/uploads/2024/01/Academic-Calender-2020-21.pdf 2 0 124888 /wp-content/uploads/2024/01/Academic-Calender-2022-23.pdf 2 0 154762 /wp-content/uploads/2024/01/Tejasvi-Bhandari-madam-FACULTY-PROFILE.pdf 2 0 332570 /wp-content/uploads/2024/02/Marathi-Dr-Dipti-Shembekar-FACULTY-PROFILE.pdf 2 0 337914 /wp-content/uploads/2024/01/Kadam-P.A.pdf 1 0 282406 /wp-content/uploads/2024/01/Jadhav-S-M.pdf 1 0 33567 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 4 Unknown 2 0 androidmarshmallow 6 0 android10 1 0 win10 24 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 6 chrome124.0.0.0 2 0 chrome109.0.0.0 4 0 chrome117.0.0.0 1 0 chrome122.0.6261.94 7 0 Unknown 1 0 chrome123.0.0.0 18 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/122.0.6261.94_Safari/537.36 20240417134330 WhatsApp/2.2414.8_W 20240418130257 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 WhatsApp/2.2414.8_W 20240418130257 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 10 From1 0 0 From2 0 1 From3 0 0 From4 0 22 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 1 www_google_com 0 1 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 301 133 0 302 12 0 406 8 1808 404 147 5924229 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 19 /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 10 - /.DS_Store 12 - /config.json 5 - /.git/config 18 - /sitemap_index.xml 4 - /.git/ 2 - /debug/default/view 12 - /static/admin/javascript/hetong.js 1 - /login.action 10 - /server 12 - /sitemap.xml.gz 2 - /s/730323e2834323e20313e2631323/_/ 10 - /Public/home/js/check.js 1 - /.vscode/sftp.json 6 - /v2/_catalog 10 - /sitemap.txt 4 - /telescope/requests 10 - /atom.xml 8 - /_all_dbs 10 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 15 103.176.135.74 0 1 630345 197.93.13.33 0 1 72071 115.98.235.154 0 2 14085 42.111.110.24 0 2 1795378 115.98.232.15 0 3 211460 66.249.68.37 0 2 136646 66.249.66.168 0 1 897689 66.249.68.36 0 2 960133 115.98.233.132 0 3 360177 152.58.19.135 0 1 630345 115.98.235.105 0 2 14085 103.176.135.79 0 7 1492532 66.249.68.38 0 2 149452 103.31.40.22 0 3 85055 115.98.234.216 0 1 12929 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 12 20240404 0 3 183042 0 20240405 0 5 1154618 0 20240406 0 3 360177 0 20240412 0 3 211460 0 20240413 0 6 1246231 0 20240417 0 2 1066646 0 20240418 0 3 2425723 0 20240419 0 1 630345 0 20240420 0 2 14085 0 20240427 0 1 12929 0 20240429 0 1 72071 0 20240430 0 2 86080 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER