AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202504 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2075 POS_TIME 2721 POS_VISITOR 6672 POS_DAY 6744 POS_DOMAIN 3272 POS_LOGIN 3483 POS_ROBOT 3638 POS_WORMS 3867 POS_EMAILSENDER 3998 POS_EMAILRECEIVER 4141 POS_SESSION 6800 POS_FILESIZE 6998 POS_SIDER 6937 POS_FILETYPES 4276 POS_DOWNLOADS 4340 POS_OS 4388 POS_BROWSER 4453 POS_SCREENSIZE 4503 POS_UNKNOWNREFERER 4577 POS_UNKNOWNREFERERBROWSER 4664 POS_ORIGIN 4746 POS_SEREFERRALS 4876 POS_PAGEREFS 5020 POS_SEARCHWORDS 5168 POS_KEYWORDS 5320 POS_MISC 2385 POS_ERRORS 5379 POS_CLUSTER 3339 POS_SIDER_404 5511 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250501071550 1 0 13474361022838 FirstTime 0 LastTime 0 LastUpdate 20250501184925 1 0 0 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 0 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 RealPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 JavaEnabled 0 0 0 PDFSupport 0 0 0 DirectorSupport 0 0 0 QuickTimeSupport 0 0 0 FlashSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 TotalMisc 0 0 0 AddToFavourites 0 8 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 3 5 446 1 0 0 0 62 62 1072248 2 0 0 0 6 6 0 3 0 0 0 3 3 0 4 0 0 0 14 17 377 5 0 0 0 6 8 0 6 0 0 0 10 12 74164 7 0 0 0 8 8 0 8 0 0 0 10 12 36972 9 0 0 0 31 31 30541 10 0 0 0 32 32 30315 11 0 0 0 0 0 0 12 0 0 0 25 25 30089 13 0 0 0 25 25 40874 14 0 0 0 22 24 0 15 0 0 0 4 6 36972 16 0 0 0 3 3 226 17 0 0 0 4 6 73944 18 0 0 0 3 3 0 19 0 0 0 0 0 0 20 0 0 0 2 2 0 21 0 0 0 14 23 130072 22 0 0 0 6 10 74384 23 0 0 0 4 4 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 0 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 bingbot/ 8 880 20250416211115 8 Googlebot/ 6 660 20250426005718 6 unknown 2 230 20250425213922 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 0 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 0 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 502 1 157 406 73 16498 301 138 0 302 2 0 404 89 1613199 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 37 /_profiler/phpinfo 2 - /.git/config 6 - /js../.git/config 2 - /static../.git/config 2 - /.aws/credentials 2 - /api/.git/config 2 - /public/.git/config 2 - /www/.git/config 2 - /template/.git/config 2 - /phpinfo.php 2 - /src/.git/config 2 - /_all_dbs 8 - /old/.git/config 2 - /admin/.git/config 2 - /sandbox/.git/config 2 - /source/.git/config 2 - /wp-content/uploads/2024/02/b.ed-syllabus-2017-18.pdf 1 - /ads.txt 4 - /staging/.git/config 2 - /plugins/.git/config 2 - /sitemaps.xml 4 - /panel/.git/config 2 - /docs/.git/config 2 - /sitemap_index.xml 4 - /dev/.git/config 2 - /app/.git/config 2 - /dist/.git/config 2 - /wp-content/.git/config 2 - /lib/.git/config 2 - /assets/.git/config 2 - /frontend/.git/config 2 - /core/.git/config 2 - /scripts/.git/config 2 - /laravel/.git/config 2 - /s3cmd.ini 2 - /logs/.git/config 2 - /media../.git/config 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 0 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 3 0-44 148 5K+ 89 100-500 90 END_FILESIZE