AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202504 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2082 POS_TIME 2754 POS_VISITOR 6589 POS_DAY 7548 POS_DOMAIN 3324 POS_LOGIN 3603 POS_ROBOT 3758 POS_WORMS 4009 POS_EMAILSENDER 4140 POS_EMAILRECEIVER 4283 POS_SESSION 7905 POS_FILESIZE 8141 POS_SIDER 8062 POS_FILETYPES 4418 POS_DOWNLOADS 4569 POS_OS 4617 POS_BROWSER 4761 POS_SCREENSIZE 4946 POS_UNKNOWNREFERER 5020 POS_UNKNOWNREFERERBROWSER 5334 POS_ORIGIN 5416 POS_SEREFERRALS 5549 POS_PAGEREFS 5693 POS_SEARCHWORDS 5841 POS_KEYWORDS 5993 POS_MISC 2418 POS_ERRORS 6052 POS_CLUSTER 3459 POS_SIDER_404 6151 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250501033938 1 0 16075193753628 FirstTime 20250401114945 LastTime 20250428141806 LastUpdate 20250501184914 1 0 0 0 0 TotalVisits 21 TotalUnique 21 MonthHostsKnown 0 MonthHostsUnknown 23 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 RealPlayerSupport 0 0 0 TotalMisc 0 0 0 PDFSupport 0 0 0 QuickTimeSupport 0 0 0 JavascriptDisabled 0 0 0 AddToFavourites 0 0 0 JavaEnabled 0 0 0 FlashSupport 0 0 0 DirectorSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 2 2 452 1 2 4 30185 0 0 0 2 0 0 0 0 0 0 3 8 10 114053 0 2 0 4 0 0 0 0 0 0 5 0 0 0 2 2 452 6 0 0 0 0 0 0 7 4 17 328968 0 4 0 8 0 0 0 4 4 126250 9 4 11 169458 0 0 0 10 9 13 130260 3 9 942 11 6 11 88817 0 10 716 12 2 3 28447 6 8 100442 13 0 0 0 2 2 716 14 8 14 224879 2 10 141011 15 0 0 0 0 0 0 16 0 0 0 0 2 0 17 2 3 28447 1 3 942 18 2 3 28447 1 3 942 19 0 0 0 2 4 28672 20 0 0 0 0 0 0 21 0 0 0 6 6 2148 22 0 0 0 0 0 0 23 0 0 0 2 4 28672 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 5 us 35 62 775395 cn 8 21 338425 gr 2 2 27956 ru 2 3 29694 be 0 1 491 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 no_user_agent 12 337599 20250427124609 0 bot[\s_+:,\.\;\/\\-] 4 55912 20250407234513 0 scrapy 2 27956 20250402085020 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 5 html 47 656966 0 0 js 12 226110 0 0 css 9 133023 0 0 png 19 18058 0 0 jpg 2 137804 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 6 Unknown 46 28 linux 13 2 macosx15 5 4 win10 8 8 macos11 16 4 androidkitkat 1 1 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 7 chrome104.0.0.0 6 6 chrome96.0.4664.110 5 4 android 1 1 chrome114.0.0.0 2 2 mozilla 46 28 chrome87.0.4280.88 16 4 chrome121.0.0.0 13 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 3 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20250413011908 Mozilla/5.0_(compatible) 20250428112324 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20250428101933 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 47 62 From1 0 0 From2 0 0 From3 0 0 From4 0 27 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 2 404 26 9308 406 7 1582 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 7 /ads.txt 8 - /public/.git/config 2 - /static../.git/config 2 - /.git/config 4 - /.git/ 4 - /robots.txt 4 - /logs/.git/config 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 23 167.94.138.35 4 6 58141 20250424033221 206.168.34.206 4 6 58141 20250428101933 111.7.96.174 4 11 169458 20250408091917 143.110.229.193 2 3 28447 20250423122745 167.94.145.106 2 4 30185 20250405074239 52.87.44.246 2 13 298783 20250408073554 167.94.146.49 2 4 30185 20250402105451 184.73.146.41 2 2 27956 20250404101235 3.84.119.191 2 2 27956 20250414145627 199.45.155.105 2 4 30185 20250401114945 206.168.34.199 2 2 27956 20250419034347 192.241.152.207 2 3 28447 20250428112318 185.247.137.187 2 2 27956 20250413011905 199.45.155.103 2 4 30185 20250402111652 88.218.193.254 2 2 27956 20250428141806 123.160.223.75 2 7 120602 20250426141304 157.230.235.214 2 3 28447 20250409170012 159.223.177.186 2 3 28447 20250414180917 98.81.54.4 2 2 27956 20250414035456 123.160.223.74 2 3 48365 20250426141305 147.124.223.62 1 1 13978 20250425101407 185.247.137.51 0 1 1738 87.236.176.163 0 1 491 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 14 20250401 2 4 30185 1 20250402 4 8 60370 2 20250404 2 2 27956 1 20250405 2 4 30185 1 20250408 6 24 468241 2 20250409 2 3 28447 1 20250413 2 4 30185 1 20250414 6 7 84359 3 20250419 2 2 27956 1 20250423 2 3 28447 1 20250424 4 6 58141 1 20250425 1 1 13978 1 20250426 4 10 168967 2 20250428 8 11 114544 3 END_DAY # Session range - Number of visits BEGIN_SESSION 2 0s-30s 19 30s-2mn 2 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 47 656966 21 21 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 5 2K-5K 4 1K-2K 10 5K+ 78 100-500 69 500-1K 3 END_FILESIZE