AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202504 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2079 POS_TIME 2742 POS_VISITOR 8929 POS_DAY 10004 POS_DOMAIN 3476 POS_LOGIN 3762 POS_ROBOT 3917 POS_WORMS 4318 POS_EMAILSENDER 4449 POS_EMAILRECEIVER 4592 POS_SESSION 10524 POS_FILESIZE 10751 POS_SIDER 10671 POS_FILETYPES 4727 POS_DOWNLOADS 4831 POS_OS 5651 POS_BROWSER 5833 POS_SCREENSIZE 6230 POS_UNKNOWNREFERER 6304 POS_UNKNOWNREFERERBROWSER 6929 POS_ORIGIN 7296 POS_SEREFERRALS 7428 POS_PAGEREFS 7572 POS_SEARCHWORDS 7720 POS_KEYWORDS 7872 POS_MISC 2405 POS_ERRORS 7931 POS_CLUSTER 3618 POS_SIDER_404 8064 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250501025606 9 2128 21782872908920 FirstTime 0 LastTime 20250430062339 LastUpdate 20250501184919 9 0 8 0 0 TotalVisits 21 TotalUnique 14 MonthHostsKnown 0 MonthHostsUnknown 31 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 FlashSupport 0 0 0 QuickTimeSupport 0 0 0 JavascriptDisabled 0 0 0 JavaEnabled 0 0 0 TotalMisc 0 0 0 AddToFavourites 0 22 0 PDFSupport 0 0 0 DirectorSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 RealPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 14 23 67774 1 4 6 1872094 6 10 85578 2 0 3 1035013 8 23 358183 3 4 10 1420543 38 42 62093 4 0 2 804334 9 14 698 5 0 0 0 12 17 140936 6 4 6 739124 42 54 1354449 7 4 8 1443674 51 62 176647 8 0 1 897689 47 54 1287607 9 0 2 238356 31 48 1461357 10 4 5 1072001 29 39 1233351 11 4 5 246383 10 16 84102 12 0 0 0 28 39 1525244 13 2 4 449283 7 23 254744 14 0 5 701678 8 27 1247155 15 0 0 0 12 20 262386 16 6 6 88340 20 36 2392688 17 2 2 592 14 21 3633116 18 0 0 0 8 15 533435 19 0 6 1246231 20 22 1303298 20 0 1 897689 10 32 3031632 21 0 0 0 5 25 5915176 22 6 6 174904 5 25 3745732 23 2 4 1795970 1 8 898530 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 5 jp 22 24 2742992 in 16 24 1847769 ca 2 2 662 cn 2 3 984845 us 0 29 9547630 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 7 Googlebot/ 73 2936931 20250429164014 54 bot[\s_+:,\.\;\/\\-] 72 5438668 20250430171142 46 facebookexternalhit/ 43 17059223 20250429102226 24 Dalvik/ 8 3041609 20250428220641 0 bingbot/ 7 738 20250430212940 6 unknown 2 246 20250409212016 2 crawl 2 1456 20250401010735 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 html 42 1040168 0 0 pdf 40 14083730 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 11 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 37 0 33214493 /wp-content/uploads/2024/01/Tejasvi-Bhandari-madam-FACULTY-PROFILE.pdf 10 0 1662850 /wp-content/uploads/2024/01/Academic-Calender-2018-19.pdf 9 0 587277 /wp-content/uploads/2024/01/Academic-Calender-2021-22.pdf 9 0 648639 /wp-content/uploads/2024/01/Faculty-Profile.pdf 8 0 336120 /wp-content/uploads/2024/01/Academic-Calender-2022-23.pdf 7 0 541667 /wp-content/uploads/2024/01/Kadam-P.A.pdf 7 0 1976842 /wp-content/uploads/2024/01/Academic-Calender-2019-20.pdf 6 0 428358 /wp-content/uploads/2024/01/Academic-Calender-2020-21.pdf 6 0 374664 /wp-content/uploads/2024/01/Department-of-English-CO.pdf 5 0 2010835 /wp-content/uploads/2024/02/Marathi-Dr-Dipti-Shembekar-FACULTY-PROFILE.pdf 4 0 675828 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 8 linuxubuntu 6 0 ios_iphone 30 24 android10 4 0 macosx15 6 0 linux 4 0 win10 17 16 androidmarshmallow 7 0 Unknown 8 2 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 17 opera31.0.1889.174 2 2 chrome42.0.2311.152 2 2 Unknown 2 2 chrome134.0.0.0 1 0 firefox132.0 6 0 chrome134.0.6998.165 5 0 edge12 6 6 chrome131.0.0.0 1 0 chrome45.0.2454.85 2 2 chrome125.0.0.0 1 0 chrome135.0.7049.95 8 0 chrome132.0.0.0 6 0 chrome114.0.0.0 4 0 safari13.0.3 30 24 chrome135.0.0.0 2 0 chrome43.0.2357.124 2 2 chrome43.0.2357.130 2 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 3 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/135.0.7049.95_Safari/537.36 20250428015245 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20250411014800 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/134.0.6998.165_Safari/537.36 20250403023829 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20250411014800 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 42 73 From1 0 0 From2 0 0 From3 0 0 From4 0 9 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 409 8 664 406 167 37742 301 228 0 302 2 0 404 61 2538634 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 15 /src/.git/config 2 - /wp-content/uploads/2024/01/department-of-english-co.pdf 1 - /.git/ 6 - /wp-content/uploads/2024/01/information-handbook-of-rti.pdf 1 - /sitemap.txt 4 - /wp-content/uploads/2024/01/academic-calender-2020-21.pdf 1 - /wp-content/uploads/2024/01/academic-calender-2021-22.pdf 1 - /sitemap 2 - /wp-content/uploads/2024/01/kadam-p.a.pdf 1 - /_all_dbs 16 - /.git/config 16 - /wp-content/uploads/2024/01/academic-calender-2022-23.pdf 1 - /wp-content/uploads/2024/01/tejasvi-bhandari-madam-faculty-profile.pdf 1 - /ads.txt 6 - /.git/HEAD 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 31 103.197.184.218 16 16 4736 20250422075433 43.130.102.223 2 2 87156 20250403164040 43.159.144.16 2 2 87156 20250425112817 43.157.250.210 2 2 87156 20250413224325 43.166.131.228 2 2 87156 20250425111345 49.51.245.241 2 2 87156 20250419102313 43.157.147.3 2 2 87156 20250419100717 43.159.143.187 2 2 87156 20250409032412 43.159.141.150 2 2 87156 20250409030937 43.157.153.236 2 2 87156 20250430062339 43.129.51.239 2 2 76054 20250409013650 198.235.24.81 2 2 662 20250411014800 43.159.152.187 2 2 87156 20250413225725 43.133.187.11 2 2 87156 20250430061050 64.49.9.17 0 6 1246231 103.216.166.32 0 1 77381 170.106.192.208 0 1 897689 170.106.167.214 0 1 897689 152.59.11.61 0 1 166285 49.51.233.95 0 1 897689 106.215.182.187 0 1 897689 43.153.15.51 0 1 897689 43.231.252.100 0 1 42015 170.106.113.235 0 1 897689 103.216.166.42 0 1 166285 43.130.9.111 0 1 897689 66.249.79.192 0 1 65253 204.137.14.67 0 6 1246231 66.249.79.206 0 8 2476230 123.252.166.232 0 4 659663 66.249.79.205 0 4 1654333 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 21 20250401 0 2 1063974 0 20250403 2 5 1128987 1 20250404 0 1 72071 0 20250406 0 2 1180095 0 20250409 6 6 250366 3 20250410 0 1 897689 0 20250411 2 8 1246893 1 20250413 4 5 216327 2 20250416 2 3 898281 1 20250417 2 3 166877 1 20250418 2 2 592 1 20250419 8 8 175496 4 20250420 0 1 897689 0 20250421 4 6 805518 2 20250422 2 5 967571 1 20250423 0 1 897689 0 20250425 4 10 1420543 2 20250426 0 2 962942 0 20250427 0 1 65253 0 20250428 0 2 975070 0 20250430 4 8 833975 2 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 21 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 42 1040168 21 21 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 5 500-1K 2 44-100 8 100-500 317 0-44 255 5K+ 195 END_FILESIZE