AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202405 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2694 POS_VISITOR 8048 POS_DAY 8862 POS_DOMAIN 3426 POS_LOGIN 3682 POS_ROBOT 3837 POS_WORMS 4174 POS_EMAILSENDER 4305 POS_EMAILRECEIVER 4448 POS_SESSION 9382 POS_SIDER 9519 POS_FILETYPES 4583 POS_DOWNLOADS 4700 POS_OS 5574 POS_BROWSER 5738 POS_SCREENSIZE 6045 POS_UNKNOWNREFERER 6119 POS_UNKNOWNREFERERBROWSER 6459 POS_ORIGIN 6541 POS_SEREFERRALS 6673 POS_PAGEREFS 6836 POS_SEARCHWORDS 6984 POS_KEYWORDS 7136 POS_MISC 2357 POS_ERRORS 7195 POS_CLUSTER 3538 POS_SIDER_404 7329 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240601082630 4 828 18625234277529 FirstTime 0 LastTime 0 LastUpdate 20240601183246 4 0 3 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 29 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 TotalMisc 0 0 0 DirectorSupport 0 0 0 JavaEnabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 RealPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 AddToFavourites 0 16 0 PDFSupport 0 0 0 JavascriptDisabled 0 0 0 FlashSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 3 1837393 2 7 497335 1 0 0 0 37 40 991399 2 0 1 402167 8 14 149944 3 0 1 65253 66 71 1911897 4 0 3 220015 14 22 167752 5 0 1 897689 43 53 1182405 6 0 0 0 66 70 1869256 7 0 0 0 14 22 572008 8 0 0 0 0 0 0 9 0 1 77381 4 18 1008088 10 0 5 2172635 8 13 83788 11 0 3 1346380 4 18 546615 12 0 5 1244639 34 41 834853 13 0 8 1266659 44 50 1944041 14 0 2 1001950 5 8 567289 15 0 6 1294635 12 16 246 16 0 3 226833 40 45 944557 17 0 8 2535349 39 48 1952270 18 0 4 1216098 35 55 1177330 19 0 4 1108907 39 50 986835 20 0 0 0 37 44 1499333 21 0 1 402167 33 37 991645 22 0 0 0 72 75 1850073 23 0 1 65253 14 22 969574 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 sc 0 1 77381 us 0 27 7852387 in 0 32 9438195 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 5 Googlebot/ 100 4260523 20240531231030 70 Go\-http\-client/ 64 20928 20240530202034 0 bingbot/ 39 1732734 20240530165126 22 Applebot/ 11 1648890 20240506092946 4 bot[\s_+:,\.\;\/\\-] 2 246 20240524103009 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 3 jpg 1 12929 0 0 png 6 214928 0 0 pdf 53 17140106 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 12 /wp-content/uploads/2024/01/Academic-Calender-2022-23.pdf 18 0 1392858 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 17 2 15274153 /wp-content/uploads/2024/01/Academic-Calender-2019-20.pdf 14 0 999502 /wp-content/uploads/2024/01/Department-of-English-CO.pdf 9 0 3619503 /wp-content/uploads/2024/02/Marathi-Dr-Dipti-Shembekar-FACULTY-PROFILE.pdf 7 0 1182699 /wp-content/uploads/2024/01/Academic-Calender-2021-22.pdf 6 0 432426 /wp-content/uploads/2024/01/Academic-Calender-2018-19.pdf 6 0 391518 /wp-content/uploads/2024/01/Faculty-Profile.pdf 5 0 210075 /wp-content/uploads/2024/01/Academic-Calender-2020-21.pdf 4 0 249776 /wp-content/uploads/2024/01/Tejasvi-Bhandari-madam-FACULTY-PROFILE.pdf 2 0 332570 /wp-content/uploads/2024/01/Kadam-P.A.pdf 2 0 564812 /wp-content/uploads/2024/01/Jadhav-S-M.pdf 1 0 33567 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 7 androidmarshmallow 10 0 android 2 0 win10 28 0 ios_iphone 1 0 Unknown 9 0 linux 1 0 android10 11 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 12 chrome124.0.6367.201 1 0 chrome109.0.0.0 3 0 chrome125.0.0.0 8 0 chrome117.0.0.0 1 0 safari17.3 1 0 chrome114.0.0.0 1 0 chrome124.0.6367.118 1 0 chrome124.0.0.0 26 0 chrome124.0.6367.155 4 0 chrome125.0.6422.65 13 0 chrome113.0.0.0 1 0 chrome122.0.0.0 2 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/125.0.6422.65_Safari/537.36 20240525053534 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/124.0.6367.155_Safari/537.36 20240515091357 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 19 From1 0 0 From2 0 2 From3 0 0 From4 0 41 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 1 www_google_com 0 2 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 302 12 0 301 202 0 406 20 4520 404 368 15030277 409 5 415 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 17 /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 32 - /v2/_catalog 32 - /s/730323e2834323e20313e2631323/_/ 32 - /.DS_Store 32 - /.git/config 32 - /enhance 2 - /_profiler/phpinfo 4 - /phpinfo.php 4 - /.vscode/sftp.json 16 - /login.action 32 - /sitemap_index.xml 4 - /server 32 - /telescope/requests 32 - /config.json 16 - /_all_dbs 32 - /sitemap.xml.gz 2 - /debug/default/view 32 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 29 66.249.68.36 0 4 1404560 152.58.18.128 0 2 149452 103.176.135.79 0 18 2897121 115.98.234.154 0 2 210304 117.223.172.126 0 1 1156 27.57.251.247 0 2 975070 66.249.68.37 0 4 1454618 223.233.82.226 0 1 897689 66.249.68.38 0 1 77381 152.58.30.252 0 1 77381 103.176.135.76 0 1 1156 66.249.77.96 0 1 71393 49.32.180.5 0 1 897689 42.106.161.73 0 1 897689 49.44.86.137 0 1 897689 115.98.233.120 0 1 1156 66.249.79.68 0 1 77381 196.240.105.233 0 1 77381 152.57.205.71 0 1 77381 152.57.81.54 0 1 897689 49.36.99.57 0 3 1346380 66.249.79.67 0 4 1407124 157.33.27.92 0 1 77381 152.58.32.212 0 1 77381 157.33.16.254 0 1 897689 66.249.66.169 0 1 77381 66.249.79.66 0 3 1028195 42.104.228.93 0 1 402167 115.98.233.225 0 1 12929 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 21 20240503 0 8 900161 0 20240504 0 3 211896 0 20240507 0 4 1301826 0 20240508 0 2 403323 0 20240510 0 2 181886 0 20240511 0 1 1156 0 20240512 0 1 168957 0 20240513 0 1 71393 0 20240514 0 1 1156 0 20240515 0 2 154762 0 20240517 0 1 402167 0 20240518 0 7 2926366 0 20240519 0 4 456642 0 20240521 0 7 3272264 0 20240522 0 2 142634 0 20240523 0 1 77381 0 20240524 0 3 1872759 0 20240525 0 2 1795378 0 20240528 0 3 226833 0 20240529 0 3 1017085 0 20240531 0 2 1795378 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER