AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202505 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2075 POS_TIME 2736 POS_VISITOR 6264 POS_DAY 6400 POS_DOMAIN 3284 POS_LOGIN 3523 POS_ROBOT 3678 POS_WORMS 3954 POS_EMAILSENDER 4085 POS_EMAILRECEIVER 4228 POS_SESSION 6500 POS_FILESIZE 6721 POS_SIDER 6646 POS_FILETYPES 4363 POS_DOWNLOADS 4462 POS_OS 4568 POS_BROWSER 4655 POS_SCREENSIZE 4746 POS_UNKNOWNREFERER 4820 POS_UNKNOWNREFERERBROWSER 5034 POS_ORIGIN 5116 POS_SEREFERRALS 5246 POS_PAGEREFS 5390 POS_SEARCHWORDS 5538 POS_KEYWORDS 5690 POS_MISC 2400 POS_ERRORS 5749 POS_CLUSTER 3379 POS_SIDER_404 5867 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250601125519 3 274 17891666117425 FirstTime 0 LastTime 20250502152311 LastUpdate 20250601151907 3 0 2 0 0 TotalVisits 1 TotalUnique 1 MonthHostsKnown 0 MonthHostsUnknown 2 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 AddToFavourites 0 8 0 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 DirectorSupport 0 0 0 PDFSupport 0 0 0 RealPlayerSupport 0 0 0 JavaEnabled 0 0 0 TotalMisc 0 0 0 JavascriptDisabled 0 0 0 FlashSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 2 2 0 1 0 0 0 0 2 220 2 0 0 0 0 0 0 3 0 0 0 2 8 440 4 0 0 0 0 0 0 5 0 0 0 8 10 36972 6 0 0 0 4 9 440 7 0 0 0 12 16 220 8 0 0 0 8 12 220 9 0 0 0 2 2 0 10 0 0 0 6 8 37418 11 0 0 0 6 6 0 12 0 0 0 1 3 446 13 0 0 0 4 6 36972 14 0 0 0 6 8 36972 15 1 1 26291 1 1 226 16 0 0 0 2 4 220 17 0 0 0 2 6 37192 18 0 0 0 0 0 0 19 0 0 0 4 6 37198 20 0 0 0 2 2 0 21 0 1 1832037 7 17 112022 22 0 0 0 24 28 111136 23 0 0 0 8 8 36972 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 2 cn 1 1 26291 us 0 1 1832037 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 4 Googlebot/ 16 1760 20250522213450 16 bingbot/ 9 880 20250518211143 8 bot[\s_+:,\.\;\/\\-] 6 660 20250531034134 6 unknown 2 220 20250525082905 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 html 1 26291 0 0 pdf 1 1832037 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 1 /wp-content/uploads/2024/02/migrationform.pdf 1 0 1832037 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 2 Unknown 1 0 linux 1 1 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 2 firefox83.0 1 1 chrome136.0.7103.113 1 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 1 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/136.0.7103.113_Safari/537.36 20250522213501 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 1 2 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 404 26 480636 302 2 0 301 90 0 406 5 1130 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 5 /sitemap_index.xml 4 - /ads.txt 8 - /sitemaps.xml 4 - /sitemap.txt 4 - /.git/config 6 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 2 47.96.10.143 1 1 26291 20250502152311 66.249.79.32 0 1 1832037 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 2 20250502 1 1 26291 1 20250522 0 1 1832037 0 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 1 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 1 26291 1 1 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 3 100-500 37 0-44 101 5K+ 28 END_FILESIZE