AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202505 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2079 POS_TIME 2741 POS_VISITOR 7562 POS_DAY 8343 POS_DOMAIN 3448 POS_LOGIN 3719 POS_ROBOT 3874 POS_WORMS 4271 POS_EMAILSENDER 4402 POS_EMAILRECEIVER 4545 POS_SESSION 8752 POS_FILESIZE 8978 POS_SIDER 8899 POS_FILETYPES 4680 POS_DOWNLOADS 4783 POS_OS 5601 POS_BROWSER 5719 POS_SCREENSIZE 5881 POS_UNKNOWNREFERER 5955 POS_UNKNOWNREFERERBROWSER 6295 POS_ORIGIN 6377 POS_SEREFERRALS 6509 POS_PAGEREFS 6653 POS_SEARCHWORDS 6801 POS_KEYWORDS 6953 POS_MISC 2404 POS_ERRORS 7012 POS_CLUSTER 3575 POS_SIDER_404 7125 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250601015732 4 836 20402367361498 FirstTime 0 LastTime 20250529180518 LastUpdate 20250601151902 4 0 3 0 0 TotalVisits 10 TotalUnique 10 MonthHostsKnown 0 MonthHostsUnknown 22 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 PDFSupport 0 0 0 DirectorSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 JavaEnabled 0 0 0 TotalMisc 0 0 0 RealPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 AddToFavourites 0 16 0 FlashSupport 0 0 0 QuickTimeSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 1 897689 6 10 1466864 1 0 0 0 8 18 1141476 2 0 1 897689 3 24 405844 3 0 0 0 0 24 1968 4 0 1 897689 9 17 420366 5 0 0 0 4 12 290506 6 2 2 85048 4 4 0 7 0 2 1795378 8 16 1063239 8 0 1 402167 13 21 445146 9 0 1 897689 9 17 246106 10 0 0 0 2 16 1065450 11 4 5 1067785 12 44 3913269 12 0 0 0 5 16 3591986 13 0 0 0 2 14 3084096 14 0 1 897689 7 11 982017 15 0 0 0 0 12 898859 16 0 0 0 0 21 3378513 17 0 0 0 10 17 4554585 18 2 2 85048 8 24 254535 19 0 1 168957 10 37 2228074 20 0 2 969760 12 33 1495008 21 0 0 0 12 41 1182386 22 12 12 518716 12 20 2291862 23 0 2 1795378 2 15 4026944 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 4 jp 18 24 6159994 us 2 7 3844761 in 0 1 402167 cn 0 2 969760 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 6 bot[\s_+:,\.\;\/\\-] 119 4529219 20250531095827 100 Googlebot/ 66 3626219 20250531214901 48 facebookexternalhit/ 32 12570020 20250529170741 18 Dalvik/ 24 9124827 20250519135047 0 [\s_+:,\.\;\/\\-]bot 16 4899414 20250531042937 8 bingbot/ 11 403397 20250514213920 10 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 html 20 858908 0 0 pdf 14 10517774 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 11 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 44 0 39498316 /wp-content/uploads/2024/01/Academic-Calender-2021-22.pdf 9 0 648639 /wp-content/uploads/2024/02/Marathi-Dr-Dipti-Shembekar-FACULTY-PROFILE.pdf 6 0 1013742 /wp-content/uploads/2024/01/Faculty-Profile.pdf 5 0 210075 /wp-content/uploads/2024/01/Academic-Calender-2020-21.pdf 5 0 312220 /wp-content/uploads/2024/01/Academic-Calender-2019-20.pdf 5 0 356965 /wp-content/uploads/2024/01/Tejasvi-Bhandari-madam-FACULTY-PROFILE.pdf 5 0 831425 /wp-content/uploads/2024/01/Academic-Calender-2022-23.pdf 5 0 386905 /wp-content/uploads/2024/01/Academic-Calender-2018-19.pdf 5 0 326265 /wp-content/uploads/2024/01/Department-of-English-CO.pdf 4 0 1608668 /wp-content/uploads/2024/01/Kadam-P.A.pdf 1 0 282406 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 4 ios_iphone 27 20 android10 2 0 Unknown 3 0 win10 2 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 5 chrome136.0.7103.113 1 0 chrome136.0.7103.59 2 0 safari13.0.3 27 20 chrome58.0.3029.110 2 0 chrome135.0.0.0 2 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/136.0.7103.59_Safari/537.36 20250510042731 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/136.0.7103.113_Safari/537.36 20250528193732 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 20 32 From1 0 0 From2 0 0 From3 0 0 From4 0 2 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 3 301 103 0 406 36 8136 404 61 3267867 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 7 /sitemap.txt 4 - /sendgrid.env 2 - /sitemaps.xml 8 - /sitemap.xml.gz 1 - /sitemap_index.xml 8 - /ads.txt 10 - /.git/config 28 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 22 170.106.197.109 2 2 85048 20250514225226 43.130.102.7 2 2 85048 20250524060518 43.157.170.126 2 2 87156 20250504224553 43.129.51.239 2 2 87154 20250509224910 43.159.140.236 2 2 85048 20250520110823 43.157.168.43 2 2 85048 20250514223722 43.130.16.140 2 3 982737 20250529180518 43.159.143.187 2 2 87154 20250509223402 43.130.110.130 2 2 85048 20250520112226 43.157.153.236 2 2 87156 20250504223306 43.133.139.6 0 1 897689 43.167.236.228 0 1 897689 43.163.206.70 0 1 897689 66.249.68.130 0 1 897689 66.249.68.128 0 1 168957 223.228.42.1 0 1 402167 66.249.68.137 0 1 897689 170.106.11.6 0 1 897689 43.153.79.218 0 1 897689 152.59.63.70 0 1 897689 43.166.253.94 0 1 897689 139.196.243.168 0 2 969760 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 16 20250501 0 1 897689 0 20250502 0 1 897689 0 20250504 4 5 576479 2 20250505 0 1 897689 0 20250506 0 1 897689 0 20250508 0 2 969760 0 20250509 4 4 174308 2 20250510 0 2 1795378 0 20250514 4 4 170096 2 20250516 0 1 897689 0 20250520 4 4 170096 2 20250521 0 1 897689 0 20250523 0 1 897689 0 20250524 2 2 85048 1 20250528 0 2 1066646 0 20250529 2 2 85048 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 10 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 20 858908 10 10 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 3 0-44 119 100-500 220 5K+ 179 END_FILESIZE