AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202306 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2718 POS_VISITOR 8093 POS_DAY 8992 POS_DOMAIN 3327 POS_LOGIN 3618 POS_ROBOT 3773 POS_WORMS 3988 POS_EMAILSENDER 4119 POS_EMAILRECEIVER 4262 POS_SESSION 9308 POS_SIDER 9483 POS_FILETYPES 4397 POS_DOWNLOADS 4667 POS_OS 4715 POS_BROWSER 4882 POS_SCREENSIZE 5257 POS_UNKNOWNREFERER 5331 POS_UNKNOWNREFERERBROWSER 5974 POS_ORIGIN 6425 POS_SEREFERRALS 6565 POS_PAGEREFS 6709 POS_SEARCHWORDS 6900 POS_KEYWORDS 7052 POS_MISC 2381 POS_ERRORS 7111 POS_CLUSTER 3474 POS_SIDER_404 7249 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20230702124007 1 0 12850248972495 FirstTime 20230607125620 LastTime 20230624114136 LastUpdate 20230702181054 1 0 0 0 0 TotalVisits 30 TotalUnique 19 MonthHostsKnown 0 MonthHostsUnknown 21 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 JavaEnabled 0 0 0 FlashSupport 0 0 0 QuickTimeSupport 0 0 0 PDFSupport 0 0 0 TotalMisc 0 0 0 RealPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 DirectorSupport 0 0 0 AddToFavourites 0 10 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 3 3 27600 0 4 22676 1 2 2 71866 0 0 0 2 0 0 0 0 0 0 3 14 15 113607 0 2 0 4 0 0 0 2 2 71866 5 0 0 0 0 0 0 6 0 0 0 0 0 0 7 0 0 0 0 0 0 8 2 2 18248 0 0 0 9 0 0 0 0 0 0 10 77 245 3868349 4 4 269 11 14 14 72226 0 0 0 12 87 251 4803593 30 31 80454 13 86 97 54085 1 1 13800 14 135 144 915100 0 0 0 15 59 64 317474 2 7 0 16 57 177 1338902 6 6 269 17 111 228 3209270 10 12 71824 18 11 11 404 1 1 21 19 0 0 0 0 0 0 20 13 13 118920 2 2 0 21 2 2 71866 0 0 0 22 2 2 18248 0 0 0 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 5 in 360 938 13830852 us 293 310 594232 ca 18 18 558178 be 2 2 18248 cn 2 2 18248 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 no_user_agent 7 215633 20230624171703 0 Go\-http\-client/ 1 13800 20230607130147 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 11 css 80 502409 0 0 woff2 1 77160 0 0 Unknown 46 129395 0 0 gif 5 41444 0 0 html 108 1793497 0 0 php 520 3136958 0 0 png 19 1681388 0 0 webp 7 83106 0 0 jpg 5 901432 0 0 js 453 6550513 0 0 svg 26 122456 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 8 macosx6 2 2 linux 10 6 android 2 2 linuxubuntu 6 2 macosx9 2 2 win10 947 364 win7 3 0 Unknown 298 297 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 16 chrome79.0.3945.79 4 0 chrome104.0.0.0 2 2 Unknown 293 293 chrome83.0.4103.61 3 0 chrome103.0.5060.114 2 2 firefox113.0 6 2 firefox88.0 2 2 chrome108.0.0.0 2 2 firefox83.0 2 2 chrome33.0.1750.152 2 2 chrome114.0.0.0 938 360 chrome63.0.3239.108 2 2 chrome112.0.5615.121 4 0 chrome99.0.4844.84 1 0 mozilla 5 4 firefox64.0 2 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 4 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20230624114136 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20230618035121 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20230608220342 WordPress/6.2.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230622204339 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 2 WordPress/6.2.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230622204339 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20230624114136 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 315 316 From1 0 0 From2 0 0 From3 10 10 From4 350 944 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 1 https://md-in-74.webhostbox.net:2083 10 10 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 6 404 14 26972 400 1 21 301 9 538 406 1 226 302 20 0 403 9 3989 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 14 /config.json 1 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 1 - /about 1 - /v2/_catalog 1 - /.vscode/sftp.json 1 - /.git/config 1 - /telescope/requests 1 - /debug/default/view 1 - /.DS_Store 1 - /static/admin/javascript/hetong.js 1 https://www.testsahyadrimahavidyalay.ptechinstitute.com/static/admin/javascript/hetong.js /s/730323e2834323e20313e2631323/_/ 1 - /_all_dbs 1 - /login.action 1 - /Public/home/js/check.js 1 https://www.testsahyadrimahavidyalay.ptechinstitute.com/Public/home/js/check.js END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 21 115.96.208.162 325 714 11721391 20230608180124 216.10.248.154 281 281 404581 20230622204339 117.222.10.23 22 130 1956147 20230620173342 117.223.172.36 13 94 153314 20230621172628 34.254.53.125 6 11 97765 20230607153023 183.129.153.157 2 2 18248 20230609135829 170.64.146.49 2 2 18248 20230610153137 198.235.24.127 2 2 71866 20230620175731 205.210.31.181 2 2 71824 20230624102621 205.210.31.167 2 2 71866 20230620100710 167.248.133.188 2 3 22367 20230618035116 87.236.176.185 2 2 18248 20230608220342 205.210.31.215 2 2 71866 20230616210817 198.235.24.21 2 2 71824 20230624114136 3.88.224.90 2 2 18248 20230613080728 205.210.31.44 2 2 71866 20230613011725 47.242.105.176 2 2 27600 20230607203126 47.254.76.138 2 2 27600 20230608003452 205.210.31.172 2 2 71866 20230613161944 205.169.39.232 0 7 20952 65.154.226.166 0 4 12071 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 11 20230607 399 570 5751526 5 20230608 187 421 6359626 8 20230609 2 2 18248 1 20230610 2 2 18248 1 20230613 6 6 161980 3 20230616 2 2 71866 1 20230618 14 15 113607 2 20230620 30 138 2118127 4 20230621 19 100 171562 2 20230622 10 10 91320 1 20230624 4 4 143648 2 END_DAY # Session range - Number of visits BEGIN_SESSION 4 15mn-30mn 2 30mn-1h 2 0s-30s 20 1h+ 6 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 34 /wp-admin/admin-ajax.php 249 1077020 2 4 /wp-cron.php 237 0 6 5 / 91 1401438 18 20 /wp-json/jetpack/v4/jitm 18 396 0 0 /wp-admin/ 8 319212 2 0 /wp-admin/load-scripts.php 8 310885 0 0 /wp-admin/load-styles.php 6 854738 0 0 /wp-admin/themes.php 5 162194 0 0 /home/ 4 48004 0 1 /wp-json/wp/v2/users/me 3 2401 0 0 /wp-admin/theme-install.php 3 79818 0 0 /wp-login.php 3 6545 0 0 /wp-json/omapp/v1/notifications 3 717 0 0 /wp-json/wp/v2/pages/8 2 2981 0 0 /wp-json/wp/v2/pages/6 2 2982 0 0 /wp-json/wp/v2/block-patterns/categories 2 1294 0 0 /wp-json/wp/v2/taxonomies/category 2 1828 0 0 /wp-json/wp/v2/block-patterns/patterns 2 105134 0 0 /wp-admin/post-new.php 2 220086 0 0 /wp-json/ 2 592 0 0 /wp-json/wp/v2/themes 2 4284 0 0 /wp-admin/post.php 2 216360 0 0 /wp-admin/edit.php 2 60644 0 0 /wp-json/wp/v2/taxonomies 2 4960 0 0 /wp-json/wp/v2/taxonomies/post_tag 2 1708 0 0 /wp-json/omapp/v1/notifications/ 1 239 0 0 /wp-admin/customize.php 1 125993 0 0 /wp-json/wp/v2/blocks 2 44 0 0 /about/ 2 24012 0 0 /wp-content/plugins/optinmonster/assets/fonts/fontawesome-webfont.woff2 1 77160 0 0 /wp-json/wp/v2/categories/1 2 576 0 0 /wp-json/wp/v2/users 2 90 0 0 /check_charset.php 1 77 1 0 /wp-admin/admin.php 1 22598 1 0 END_SIDER