AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202406 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2686 POS_VISITOR 6492 POS_DAY 6564 POS_DOMAIN 3244 POS_LOGIN 3455 POS_ROBOT 3610 POS_WORMS 3820 POS_EMAILSENDER 3951 POS_EMAILRECEIVER 4094 POS_SESSION 6620 POS_SIDER 6757 POS_FILETYPES 4229 POS_DOWNLOADS 4293 POS_OS 4341 POS_BROWSER 4406 POS_SCREENSIZE 4456 POS_UNKNOWNREFERER 4530 POS_UNKNOWNREFERERBROWSER 4617 POS_ORIGIN 4699 POS_SEREFERRALS 4829 POS_PAGEREFS 4973 POS_SEARCHWORDS 5121 POS_KEYWORDS 5273 POS_MISC 2350 POS_ERRORS 5332 POS_CLUSTER 3311 POS_SIDER_404 5455 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240701003904 1 0 8428527658459 FirstTime 0 LastTime 0 LastUpdate 20240701183018 1 0 0 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 0 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 QuickTimeSupport 0 0 0 DirectorSupport 0 0 0 TotalMisc 0 0 0 JavaEnabled 0 0 0 FlashSupport 0 0 0 PDFSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 AddToFavourites 0 2 0 RealPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 37 39 413095 1 0 0 0 6 6 904 2 0 0 0 10 10 74868 3 0 0 0 44 46 407948 4 0 0 0 6 6 0 5 0 0 0 4 4 0 6 0 0 0 9 9 226 7 0 0 0 6 6 0 8 0 0 0 4 4 0 9 0 0 0 33 33 408188 10 0 0 0 37 37 364083 11 0 0 0 37 37 375923 12 0 0 0 37 39 316266 13 0 0 0 8 13 92820 14 0 0 0 61 62 837823 15 0 0 0 12 14 220 16 0 0 0 2 4 36952 17 0 0 0 10 10 36952 18 0 0 0 6 6 0 19 0 0 0 6 6 0 20 0 0 0 8 10 220 21 0 0 0 2 2 0 22 0 0 0 0 0 0 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 0 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 Go\-http\-client/ 28 8750 20240630124930 0 bingbot/ 12 1320 20240630123144 12 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 0 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 0 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 406 16 3616 404 192 3352802 301 139 0 302 14 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 29 /telescope/requests 14 - /debug/default/view 12 - /config.json 7 - /Public/home/js/check.js 1 - /_all_dbs 14 - /sitemap.xml.gz 2 - /events../.git/config 2 - /images../.git/config 2 - /.DS_Store 14 - /sitemaps.xml 4 - /_profiler/phpinfo 2 - /media../.git/config 2 - /css../.git/config 2 - /assets../.git/config 2 - /login.action 14 - /content../.git/config 2 - /sitemap_index.xml 4 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 14 - /lib../.git/config 2 - /s/730323e2834323e20313e2631323/_/ 14 - /static../.git/config 2 - /img../.git/config 2 - /static/admin/javascript/hetong.js 1 - /v2/_catalog 14 - /phpinfo.php 2 - /js../.git/config 2 - /.vscode/sftp.json 7 - /.git/config 18 - /server 14 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 0 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER