AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202406 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2048 POS_TIME 2713 POS_VISITOR 8617 POS_DAY 11312 POS_DOMAIN 3362 POS_LOGIN 3787 POS_ROBOT 3942 POS_WORMS 4247 POS_EMAILSENDER 4378 POS_EMAILRECEIVER 4521 POS_SESSION 11790 POS_SIDER 11957 POS_FILETYPES 4656 POS_DOWNLOADS 4831 POS_OS 4879 POS_BROWSER 5169 POS_SCREENSIZE 5780 POS_UNKNOWNREFERER 5854 POS_UNKNOWNREFERERBROWSER 6413 POS_ORIGIN 6780 POS_SEREFERRALS 6915 POS_PAGEREFS 7059 POS_SEARCHWORDS 7207 POS_KEYWORDS 7359 POS_MISC 2377 POS_ERRORS 7418 POS_CLUSTER 3643 POS_SIDER_404 7528 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240701011750 24 5644 15383822155144 FirstTime 0 LastTime 20240630212550 LastUpdate 20240701182956 24 0 23 0 0 TotalVisits 70 TotalUnique 63 MonthHostsKnown 0 MonthHostsUnknown 69 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 JavascriptDisabled 0 0 0 FlashSupport 0 0 0 TotalMisc 0 0 0 JavaEnabled 0 0 0 AddToFavourites 0 0 0 RealPlayerSupport 0 0 0 DirectorSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 PDFSupport 0 0 0 QuickTimeSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 8 10 325067 0 0 0 1 0 0 0 6 6 99726 2 2 2 27956 0 0 0 3 19 20 392771 64 68 272284 4 2 3 28447 2 2 98294 5 7 7 168184 1 1 226 6 14 22 450405 3 10 3305 7 6 8 156435 0 4 716 8 6 15 199643 0 2 0 9 7 48 26095908 2 2 98294 10 4 4 55912 6 13 297388 11 3 8 134580 1 2 20635 12 6 6 83868 0 0 0 13 2 4 30185 2 4 166 14 8 8 252500 0 0 0 15 7 7 97846 0 0 0 16 16 16 280008 4 4 99010 17 12 15 240794 2 9 29879 18 8 8 393176 0 0 0 19 10 11 351285 0 0 0 20 4 4 196588 2 3 28447 21 4 12 171196 0 2 0 22 2 4 30185 2 2 452 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 15 us 69 120 27747407 ca 20 31 907289 cn 16 26 409005 ru 10 10 111824 fr 8 8 393176 zz 8 17 226352 ua 4 4 55912 in 4 4 55912 jp 4 4 55912 be 4 8 60370 eu 2 2 27956 pa 2 2 27956 gb 2 2 27956 vn 2 2 27956 au 2 2 27956 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 4 no_user_agent 18 884646 20240630033641 0 Go\-http\-client/ 8 57344 20240630033658 0 scanner 6 56894 20240630202238 0 (firefox/)([0-9]\.|[0-1][0]\.) 1 20409 20240630113757 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 6 woff2 5 537996 0 0 js 29 544866 0 0 png 21 19040 0 0 html 152 3644136 0 0 jpg 26 25283878 0 0 css 9 133023 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 17 macosx 16 4 win7 7 6 android 4 4 symbian 2 2 winlong 2 2 macosx15 52 45 macosx6 1 0 winxp 1 0 androidkitkat 2 2 win8 1 0 linuxubuntu 8 8 android10 6 6 win10 37 35 linux 56 11 win2000 1 0 Unknown 42 28 androidmarshmallow 4 4 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 28 opera11.11 1 0 firefox25.0 1 0 chrome110.0.0.0 4 4 chrome34.0.1847.137 1 0 opera11.62 1 0 chrome40.0.2214.93 1 0 chrome117.0.0.0 12 12 chrome108.0.0.0 6 6 chrome87.0.4280.88 16 4 Unknown 14 14 opera11.10 2 2 chrome121.0.0.0 68 27 firefox63.0 1 0 mozilla 34 16 chrome122.0.0.0 6 6 android 2 2 chrome68.0.3440.84 2 2 chrome52.0.3624.98 4 4 chrome74.0.3729.169 2 2 firefox45.66.18 1 0 chrome100.0.4896.60 16 16 chrome96.0.4664.110 25 18 chrome124.0.0.0 2 2 safari2.0.1 2 2 chrome79.0.3945.130 4 4 chrome71.0.2623.112 2 2 firefox115.0 8 8 chrome103.0.5060.114 4 4 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 3 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240628190335 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20240630211138 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20240630000236 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240628190335 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 152 184 From1 0 0 From2 0 0 From3 0 0 From4 5 58 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 3 409 3 249 404 78 27924 406 6 1356 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 26 /static/admin/javascript/hetong.js 2 - /debug/default/view 4 - /server 4 - /js/main.js 2 - /s/730323e2834323e20313e2631323/_/ 4 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 4 - /vendor/glightbox/js/glightbox.min.js 2 - /about 4 - //maxcdn.bootstrapcdn.com/bootstrap/3.4.1/js/bootstrap.min.js 2 - /vendor/purecounter/purecounter_vanilla.js 2 - /v2/_catalog 4 - /.git/config 8 - /vendor/php-email-form/validate.js 2 - /login.action 4 - /phpinfo.php 2 - /telescope/requests 4 - //ajax.googleapis.com/ajax/libs/jquery/3.6.3/jquery.min.js 2 - /_all_dbs 4 - /.DS_Store 4 - /appointment.php 2 - /vendor/bootstrap/js/bootstrap.bundle.min.js 2 - /.vscode/sftp.json 2 - /_profiler/phpinfo 2 - /robots.txt 2 - /config.json 2 - /Public/home/js/check.js 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 69 23.145.40.147 8 17 226352 20240630081858 52.87.44.246 7 48 26095908 20240619095641 3.236.91.98 4 4 196588 20240606062102 35.171.144.152 4 4 196588 20240621185519 54.88.179.33 4 4 196588 20240615004600 45.148.10.59 4 4 55912 20240625102103 47.242.224.70 4 15 261613 20240630212550 51.254.49.97 4 4 196588 20240630185839 133.242.174.119 4 4 55912 20240630190847 195.211.77.142 4 4 55912 20240630160850 95.217.18.177 4 4 55912 20240630033656 111.7.96.176 4 11 169458 20240615061619 154.28.229.0 3 3 41934 20240630164432 104.164.173.104 3 3 41934 20240630153332 206.217.206.66 2 2 27956 20240630033653 199.45.155.93 2 4 30185 20240627082254 188.165.87.109 2 2 98294 20240630170145 165.227.140.38 2 2 27956 20240623055026 111.7.100.31 2 2 27956 20240620032211 47.88.90.156 2 2 27956 20240630174541 104.164.173.73 2 2 27956 20240630153328 111.7.100.32 2 2 27956 20240602032637 147.185.132.34 2 2 98294 20240619192315 171.244.43.14 2 2 27956 20240630164926 178.62.213.220 2 2 27956 20240627071417 104.164.173.107 1 1 13978 20240630153348 111.7.96.165 2 3 28447 20240623064113 44.204.137.99 2 2 98294 20240625202053 199.45.155.26 2 4 30185 20240617130545 188.165.87.102 2 2 98294 20240630165644 111.7.100.35 0 1 491 159.89.100.138 2 2 27956 20240605124142 128.199.42.20 2 2 27956 20240623162705 179.43.167.18 2 2 27956 20240630064008 36.99.136.137 0 1 491 206.81.12.187 2 2 98294 20240630033646 198.235.24.9 2 2 98294 20240628190335 205.210.31.87 2 2 98294 20240627001400 159.65.189.145 2 2 27956 20240627142910 154.28.229.143 1 1 13978 20240630153422 205.210.31.57 2 2 98294 20240628140025 138.197.191.87 2 2 98294 20240630033644 159.223.118.152 2 2 27956 20240610124928 79.137.248.15 2 2 27956 20240615114931 87.236.176.77 2 2 27956 20240630000235 195.211.77.140 2 2 0 20240630160838 198.235.24.78 2 2 98294 20240605194029 47.251.15.21 2 2 27956 20240630174541 36.99.136.128 2 2 27956 20240628045318 209.97.129.20 2 2 27956 20240625124228 143.110.219.50 2 2 27956 20240625055452 139.59.12.165 2 2 27956 20240619165233 87.236.176.40 2 2 27956 20240610221359 87.236.176.25 0 1 1738 154.28.229.152 2 2 27956 20240630164426 199.45.155.110 2 4 30185 20240629073051 185.209.196.166 2 2 27956 20240630033704 199.45.154.141 2 4 30185 20240630211131 87.236.176.45 0 1 1738 54.208.200.199 2 2 98294 20240625202057 34.0.79.148 2 2 27956 20240607023907 87.236.176.217 0 1 491 36.99.136.136 2 2 27956 20240610144928 115.231.78.8 2 2 98294 20240618072000 205.210.31.51 2 2 98294 20240621051300 206.189.106.132 2 2 27956 20240624175222 87.236.176.59 0 1 491 198.235.24.219 2 2 98294 20240615143944 199.45.155.23 2 4 30185 20240605171246 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 19 20240602 3 4 42425 2 20240605 6 8 156435 3 20240606 4 4 196588 1 20240607 2 2 27956 1 20240610 6 8 86097 3 20240615 11 18 478318 4 20240616 2 3 28447 1 20240617 2 4 30185 1 20240618 2 2 98294 1 20240619 11 52 26222158 3 20240620 2 2 27956 1 20240621 6 6 294882 2 20240623 6 7 84359 3 20240624 4 5 56403 2 20240625 12 12 308412 5 20240627 8 10 184391 4 20240628 6 7 225035 3 20240629 2 4 30185 1 20240630 62 84 1584413 29 END_DAY # Session range - Number of visits BEGIN_SESSION 3 30s-2mn 1 0s-30s 68 30mn-1h 1 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 6 / 152 3644136 70 69 /assets/vendor/fontawesome-free/webfonts/fa-regular-400.woff2 1 25236 0 0 /assets/vendor/remixicon/remixicon.woff2 1 125268 0 0 /assets/vendor/fontawesome-free/webfonts/fa-solid-900.woff2 1 150516 0 0 /assets/vendor/bootstrap-icons/fonts/bootstrap-icons.woff2 1 121296 0 1 /assets/vendor/boxicons/fonts/boxicons.woff2 1 115680 0 0 END_SIDER