AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202406 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2710 POS_VISITOR 7819 POS_DAY 8336 POS_DOMAIN 3436 POS_LOGIN 3693 POS_ROBOT 3848 POS_WORMS 4103 POS_EMAILSENDER 4234 POS_EMAILRECEIVER 4377 POS_SESSION 8781 POS_SIDER 8927 POS_FILETYPES 4512 POS_DOWNLOADS 4610 POS_OS 5429 POS_BROWSER 5578 POS_SCREENSIZE 5880 POS_UNKNOWNREFERER 5954 POS_UNKNOWNREFERERBROWSER 6295 POS_ORIGIN 6377 POS_SEREFERRALS 6509 POS_PAGEREFS 6653 POS_SEARCHWORDS 6801 POS_KEYWORDS 6953 POS_MISC 2373 POS_ERRORS 7012 POS_CLUSTER 3549 POS_SIDER_404 7156 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240701021910 37 7226 8930171208243 FirstTime 0 LastTime 20240605233906 LastUpdate 20240701183002 37 0 36 0 0 TotalVisits 1 TotalUnique 1 MonthHostsKnown 0 MonthHostsUnknown 17 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 PDFSupport 0 0 0 AddToFavourites 0 14 0 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 JavaEnabled 0 0 0 RealPlayerSupport 0 0 0 DirectorSupport 0 0 0 TotalMisc 0 0 0 FlashSupport 0 0 0 JavascriptDisabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 1 62444 70 72 1763272 1 0 1 42015 41 49 1175986 2 0 2 134515 70 77 1951109 3 0 0 0 44 51 991941 4 0 2 238356 2 7 42507 5 0 3 291173 7 11 718 6 0 1 282406 5 6 250013 7 0 2 104459 37 51 1030286 8 0 2 448691 76 93 2425022 9 0 1 62444 8 20 756950 10 0 0 0 39 48 1166781 11 0 0 0 76 80 1826509 12 0 1 42015 41 45 867479 13 0 0 0 48 54 1053649 14 0 7 1288246 47 54 1048869 15 0 0 0 4 6 83748 16 0 1 168957 7 10 125517 17 0 2 143464 6 12 738 18 0 4 277149 45 53 1041581 19 0 4 659663 45 50 1172813 20 0 3 1222110 35 42 970188 21 0 0 0 4 10 474052 22 0 0 0 138 138 3567780 23 2 3 898155 177 185 4499316 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 cn 2 8 1246697 in 0 6 2455041 us 0 26 2664524 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 Go\-http\-client/ 110 35562 20240630183511 2 Googlebot/ 98 1849150 20240630143939 76 bingbot/ 39 1492929 20240630215312 22 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 pdf 38 6365796 0 0 html 2 466 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 11 /wp-content/uploads/2024/01/Academic-Calender-2019-20.pdf 17 0 1213681 /wp-content/uploads/2024/01/Faculty-Profile.pdf 10 0 420150 /wp-content/uploads/2024/01/Academic-Calender-2020-21.pdf 9 0 561996 /wp-content/uploads/2024/01/Tejasvi-Bhandari-madam-FACULTY-PROFILE.pdf 7 0 1163995 /wp-content/uploads/2024/01/Academic-Calender-2021-22.pdf 6 0 432426 /wp-content/uploads/2024/01/Kadam-P.A.pdf 6 0 1694436 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 3 0 2693067 /wp-content/uploads/2024/01/Academic-Calender-2022-23.pdf 2 0 154762 /wp-content/uploads/2024/01/Department-of-English-CO.pdf 2 0 804334 /wp-content/uploads/2024/02/Marathi-Dr-Dipti-Shembekar-FACULTY-PROFILE.pdf 2 0 337914 /wp-content/uploads/2024/01/Academic-Calender-2018-19.pdf 2 0 130506 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 6 win10 11 0 android10 5 0 macosx 2 2 android 2 0 Unknown 11 0 androidmarshmallow 9 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 11 chrome109.0.0.0 1 0 chrome125.0.6422.174 1 0 chrome125.0.6422.175 13 0 chrome125.0.6422.168 3 0 chrome124.0.6367.179 1 0 chrome106.0.5249.126 1 0 chrome125.0.6422.141 3 0 chrome107.0.0.0 6 0 chrome125.0.0.0 8 0 chrome84.0.1362 2 2 chrome118.0.0.0 1 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/125.0.6422.175_Safari/537.36 20240629020643 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/125.0.6422.141_Safari/537.36 20240603072335 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 2 29 From1 0 0 From2 0 0 From3 0 0 From4 0 11 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 6 301 298 0 429 1 210 409 2 166 404 616 24902027 302 16 0 406 30 6780 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 14 /s/730323e2834323e20313e2631323/_/ 54 - /telescope/requests 54 - /config.json 27 - /_profiler/phpinfo 2 - /debug/default/view 54 - /server 54 - /_all_dbs 54 - /.DS_Store 56 - /.git/config 70 - /.vscode/sftp.json 27 - /login.action 54 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 54 - /phpinfo.php 2 - /v2/_catalog 54 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 17 106.75.65.221 2 2 466 20240605233906 66.249.68.37 0 2 124888 43.251.92.230 0 4 659663 66.249.73.77 0 1 72071 136.232.13.210 0 1 168957 110.227.31.65 0 1 897689 152.57.213.219 0 1 42015 66.249.79.67 0 2 237678 66.249.77.97 0 1 282406 117.132.188.205 0 6 1246231 49.14.218.31 0 1 897689 66.249.79.68 0 4 669271 66.249.68.36 0 3 196959 66.249.77.98 0 2 208300 66.249.77.96 0 1 62444 152.58.16.60 0 4 277149 66.249.79.66 0 4 322386 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 18 20240601 0 5 1557352 0 20240602 0 5 339593 0 20240603 0 2 84030 0 20240604 0 6 1246231 0 20240605 2 2 466 1 20240606 0 1 897689 0 20240610 0 2 448691 0 20240611 0 1 72071 0 20240612 0 1 42015 0 20240613 0 1 42015 0 20240614 0 3 520084 0 20240617 0 1 62444 0 20240618 0 2 344850 0 20240619 0 3 270744 0 20240626 0 1 168957 0 20240627 0 1 62444 0 20240628 0 2 134515 0 20240629 0 1 72071 0 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 1 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 2 466 1 1 END_SIDER