AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202506 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2082 POS_TIME 2744 POS_VISITOR 9161 POS_DAY 10243 POS_DOMAIN 3388 POS_LOGIN 3686 POS_ROBOT 3841 POS_WORMS 4249 POS_EMAILSENDER 4380 POS_EMAILRECEIVER 4523 POS_SESSION 10559 POS_FILESIZE 10882 POS_SIDER 10716 POS_FILETYPES 4658 POS_DOWNLOADS 4793 POS_OS 4841 POS_BROWSER 5257 POS_SCREENSIZE 6176 POS_UNKNOWNREFERER 6250 POS_UNKNOWNREFERERBROWSER 6598 POS_ORIGIN 6680 POS_SEREFERRALS 6813 POS_PAGEREFS 6957 POS_SEARCHWORDS 7105 POS_KEYWORDS 7257 POS_MISC 2408 POS_ERRORS 7316 POS_CLUSTER 3542 POS_SIDER_404 7429 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250701012315 9 1643 12732260039652 FirstTime 0 LastTime 20250630192949 LastUpdate 20250701184843 9 0 8 0 0 TotalVisits 24 TotalUnique 23 MonthHostsKnown 0 MonthHostsUnknown 27 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 WindowsMediaPlayerSupport 0 0 0 RealPlayerSupport 0 0 0 PDFSupport 0 0 0 JavaEnabled 0 0 0 FlashSupport 0 0 0 DirectorSupport 0 0 0 TotalMisc 0 0 0 QuickTimeSupport 0 0 0 JavascriptDisabled 0 0 0 AddToFavourites 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 4 6 58141 4 6 99010 1 0 0 0 4 4 196588 2 0 0 0 8 11 31046 3 2 4 30185 0 0 0 4 0 0 0 2 2 716 5 4 6 58141 48 50 17184 6 4 5 50292 0 2 716 7 12 44 646526 8 48 71321 8 0 27 469412 41 99 8666937 9 2 3 28447 29 48 5159152 10 4 5 56403 0 2 716 11 4 6 58141 0 2 0 12 2 3 28447 0 0 0 13 4 5 56403 20 91 55011 14 11 15 158216 2 7 942 15 1 1 0 4 7 39098 16 3 5 44163 3 7 28898 17 1 2 15716 0 2 0 18 4 6 58141 0 2 0 19 5 9 74348 0 3 226 20 2 16 256295 34 55 8431126 21 3 5 44163 0 1 0 22 0 0 0 43 64 8526136 23 0 0 0 4 6 99010 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 6 us 48 74 677338 gb 12 71 1115938 fr 4 16 282022 be 4 5 56403 pa 2 2 27956 ru 2 5 31923 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 7 bot[\s_+:,\.\;\/\\-] 213 30637086 20250617224732 0 curl 10 491470 20250630232823 0 scrapy 4 55912 20250604092357 0 msnbot\-media/ 1 20409 20250623080003 0 validator 1 55045 20250623080147 0 ELinks[\x20]\( 1 55045 20250623075848 0 facebookexternalhit/ 1 20409 20250623080218 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 4 png 30 30941 0 0 css 9 133023 0 0 html 72 934919 0 0 js 62 1092697 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 25 winlong 1 0 win7 8 0 androidgingerbread 1 0 androiddonut 1 0 Unknown 65 39 ios_iphone 1 0 linux 24 14 macosx4 1 0 androidpie 2 0 bsdfreebsd 1 0 ios_ipad 1 0 win10 21 7 android12 4 0 symbian 1 0 win8.1 1 0 macosx15 6 2 androidoreo 1 0 macosx10 2 0 androidnougat 1 0 linuxubuntu 1 0 macos11 25 10 bsdopenbsd 1 0 blackberry 1 0 win2003 1 0 macosx14 1 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 46 chrome122.0.0.0 1 1 msie9.0 1 0 netscape5.0 16 4 firefox19.0 1 0 chrome60.0.3112.107 1 0 chrome103.0.5056.0 1 0 chrome121.0.0.0 2 2 chrome30.0.1599.101 1 0 chrome132.0.0.0 2 2 opera11.00 1 0 firefox28.0 1 0 chrome19.0.1084.56 1 0 firefox25.0 1 0 chrome135.0.0.0 6 4 safari7.1.0.267 1 0 android 1 0 sonyericsson 1 0 chrome137.0.0.0 9 6 chrome101.0.4951.54 4 0 chrome30.0.1599.114 1 0 chrome101.0.4951.41 4 0 epiphany 1 0 chrome91.0.4472.124 1 0 safari15.4 2 2 chrome100.0.4896.60 1 0 lynx 1 0 chrome52.0.2743.116 1 0 chrome55.0.2859.0 1 0 mozilla 64 39 msie10.0 2 0 chrome101.0.4951.61 2 0 safari10.0 1 0 firefox40.0 1 0 chrome51.0.2704.79 1 0 opera62.0.3331.116 2 2 chrome101.0.0.0 1 0 safari5.0.2 1 0 chrome20.0.1092.0 1 0 chrome62.0.3178.0 1 0 msie7.0 1 0 chrome98.0.4758.102 1 0 nokia 1 0 safari11.0 1 0 firefox36.0 1 0 chrome5.0.310.0 1 0 chrome87.0.4280.88 25 10 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 3 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20250626213535 Lynx/2.8.7dev.4_libwww-FM/2.14_SSL-MM/1.4.1_OpenSSL/0.9.8d 20250623075925 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20250630192950 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 72 168 From1 0 0 From2 0 0 From3 0 0 From4 0 5 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 3 404 237 84846 409 19 1577 406 9 2034 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 47 /vendor/animate.css/animate.min.css 1 - /sandbox/.git/config 2 - /logs/.git/config 2 - /public/.git/config 2 - /vendor/glightbox/js/glightbox.min.js 17 - /backend/.git/config 2 - //maxcdn.bootstrapcdn.com/bootstrap/3.4.1/js/bootstrap.min.js 9 - /assets/vendor/purecounter/purecounter.js 9 - /plugins/.git/config 2 - /dist/.git/config 2 - /src/.git/config 2 - /staging/.git/config 2 - /app/.git/config 2 - /vendor/fontawesome-free/css/all.min.css 1 - //ajax.googleapis.com/ajax/libs/jquery/3.6.3/jquery.min.js 8 - /vendor/boxicons/css/boxicons.min.css 1 - /vendor/swiper/swiper-bundle.min.css 1 - /old/.git/config 2 - /source/.git/config 2 - /js/main.js 18 - /static../.git/config 2 - /scripts/.git/config 2 - /sitemap.xml 2 - /vendor/remixicon/remixicon.css 1 - /vendor/bootstrap-icons/bootstrap-icons.css 1 - /vendor/php-email-form/validate.js 18 - /laravel/.git/config 2 - /docs/.git/config 2 - /.git/HEAD 2 - /test/.git/config 2 - /vendor/bootstrap/js/bootstrap.bundle.min.js 18 - /panel/.git/config 2 - /vendor/purecounter/purecounter_vanilla.js 18 - /robots.txt 18 - /assets/vendor/purecounter/gi 2 - /www/.git/config 2 - /css/style.css 1 - /.git/config 18 - /js../.git/config 2 - /ads.txt 8 - /frontend/.git/config 2 - /vendor/bootstrap/css/bootstrap.min.css 1 - /lib/.git/config 2 - /vendor/swiper/swiper-bundle.min.js 17 - /assets/.git/config 2 - /admin/.git/config 2 - /vendor/glightbox/css/glightbox.min.css 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 27 141.98.11.115 12 71 1115938 20250623075606 206.168.34.94 7 11 102304 20250626140454 162.142.125.118 4 6 58141 20250620181232 167.94.138.122 4 6 58141 20250623005713 86.104.252.57 4 16 282022 20250603143622 167.94.145.98 4 6 58141 20250620141438 167.94.138.59 4 6 58141 20250626055541 162.142.125.205 3 5 44163 20250626162605 206.168.34.69 3 5 44163 20250626213535 199.45.154.143 3 5 44163 20250626193452 209.38.242.3 2 3 28447 20250623132419 138.197.168.7 2 3 28447 20250618065419 165.22.232.110 2 3 28447 20250604105045 87.236.176.27 2 2 27956 20250630192949 179.43.149.114 2 2 27956 20250608134535 134.122.47.38 2 3 28447 20250609093402 52.87.44.246 2 2 21845 20250618062128 199.45.154.154 2 4 30185 20250626200733 94.159.108.209 2 2 27956 20250605103859 159.65.37.243 2 3 28447 20250630124305 87.236.176.106 2 2 27956 20250610032140 3.145.110.23 1 1 0 20250611153850 206.168.34.85 1 2 15716 20250626170135 185.247.137.52 0 1 1738 185.247.137.180 0 1 1738 87.236.176.182 0 1 491 185.247.137.176 0 1 491 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 12 20250603 4 16 282022 1 20250604 2 3 28447 1 20250605 2 2 27956 1 20250608 2 2 27956 1 20250609 2 3 28447 1 20250610 2 4 30185 1 20250611 1 1 0 1 20250618 4 5 50292 2 20250620 8 12 116282 2 20250623 18 80 1202526 3 20250626 23 38 338835 8 20250630 4 7 58632 2 END_DAY # Session range - Number of visits BEGIN_SESSION 2 30s-2mn 9 0s-30s 15 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 4 / 66 902459 24 23 /princi_desk.html 2 10772 0 0 /about.html 2 11488 0 1 /vision_mission.html 2 10200 0 0 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 7 5K+ 305 1K-2K 28 100-500 284 2K-5K 38 44-100 19 500-1K 17 0-44 1 END_FILESIZE