AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202506 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2079 POS_TIME 2744 POS_VISITOR 7265 POS_DAY 7663 POS_DOMAIN 3344 POS_LOGIN 3597 POS_ROBOT 3752 POS_WORMS 4053 POS_EMAILSENDER 4184 POS_EMAILRECEIVER 4327 POS_SESSION 7850 POS_FILESIZE 8097 POS_SIDER 7996 POS_FILETYPES 4462 POS_DOWNLOADS 4577 POS_OS 5112 POS_BROWSER 5228 POS_SCREENSIZE 5333 POS_UNKNOWNREFERER 5407 POS_UNKNOWNREFERERBROWSER 5779 POS_ORIGIN 6146 POS_SEREFERRALS 6277 POS_PAGEREFS 6421 POS_SEARCHWORDS 6569 POS_KEYWORDS 6721 POS_MISC 2408 POS_ERRORS 6780 POS_CLUSTER 3453 POS_SIDER_404 6911 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250613121921 16 4450 13715548545028 FirstTime 0 LastTime 20250613084320 LastUpdate 20250613133227 16 0 16 0 0 TotalVisits 5 TotalUnique 5 MonthHostsKnown 0 MonthHostsUnknown 10 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 DirectorSupport 0 0 0 QuickTimeSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 JavaEnabled 0 0 0 FlashSupport 0 0 0 RealPlayerSupport 0 0 0 AddToFavourites 0 6 0 TotalMisc 0 0 0 PDFSupport 0 0 0 JavascriptDisabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 0 0 0 0 8 984 2 0 1 897689 0 9 1210 3 0 0 0 31 34 488017 4 0 0 0 4 8 248471 5 0 1 897689 7 7 163654 6 0 0 0 14 23 82904 7 0 2 448691 2 4 246 8 1 1 7890 4 9 82638 9 0 0 0 2 17 1722 10 0 0 0 2 12 167446 11 0 0 0 0 3 42181 12 0 0 0 7 11 892 13 0 0 0 2 2 81714 14 0 0 0 10 20 3924065 15 2 2 85048 0 3 897935 16 2 2 85048 0 0 0 17 4 4 170096 0 6 738 18 0 0 0 3 12 1436 19 0 0 0 6 12 698 20 0 0 0 1 1 226 21 0 0 0 4 11 147459 22 0 1 897689 1 1 226 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 jp 8 11 3033259 ca 1 1 7890 us 0 2 448691 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 4 bot[\s_+:,\.\;\/\\-] 52 6396 20250613021433 52 Googlebot/ 27 611255 20250612043147 20 facebookexternalhit/ 5 4488445 20250607142423 0 bingbot/ 1 402167 20250603031302 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 3 php 1 7890 0 0 pdf 5 3141758 0 0 html 8 340192 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 7 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 8 0 7181512 /wp-content/uploads/2024/01/Tejasvi-Bhandari-madam-FACULTY-PROFILE.pdf 3 0 498855 /wp-content/uploads/2024/02/Marathi-Dr-Dipti-Shembekar-FACULTY-PROFILE.pdf 1 0 168957 /wp-content/uploads/2024/01/Kadam-P.A.pdf 1 0 282406 /wp-content/uploads/2024/01/Department-of-English-CO.pdf 1 0 402167 /wp-content/uploads/2024/01/Academic-Calender-2018-19.pdf 1 0 65253 /wp-content/uploads/2024/01/Faculty-Profile.pdf 1 0 42015 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 3 androidmarshmallow 2 0 ios_iphone 11 8 Unknown 1 1 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 3 safari13.0.3 11 8 Unknown 1 1 chrome136.0.7103.113 2 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 1 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20250613084320 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20250613084320 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 9 14 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 404 20 817208 409 5 415 429 4 840 301 57 0 406 36 8136 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 3 /.git/config 16 - /_all_dbs 2 - /ads.txt 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 10 43.157.95.131 2 2 85048 20250603174057 43.165.70.220 2 2 85048 20250608155330 43.157.53.115 2 2 85048 20250603172725 43.130.67.33 2 2 85048 20250608160706 205.210.31.22 1 1 7890 20250613084320 43.135.139.165 0 1 897689 66.249.66.169 0 1 282406 66.249.66.15 0 1 166285 43.130.139.177 0 1 897689 43.128.156.124 0 1 897689 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 6 20250601 0 1 897689 0 20250603 4 4 170096 2 20250607 0 3 1346380 0 20250608 4 4 170096 2 20250612 0 1 897689 0 20250613 1 1 7890 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 5 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 2 / 8 340192 4 4 /wp-login.php 1 7890 1 1 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 4 44-100 5 0-44 65 100-500 112 5K+ 45 END_FILESIZE