AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202307 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2719 POS_VISITOR 6977 POS_DAY 7517 POS_DOMAIN 3351 POS_LOGIN 3620 POS_ROBOT 3775 POS_WORMS 3946 POS_EMAILSENDER 4077 POS_EMAILRECEIVER 4220 POS_SESSION 8118 POS_SIDER 8325 POS_FILETYPES 4355 POS_DOWNLOADS 4703 POS_OS 4751 POS_BROWSER 4880 POS_SCREENSIZE 5057 POS_UNKNOWNREFERER 5131 POS_UNKNOWNREFERERBROWSER 5526 POS_ORIGIN 5729 POS_SEREFERRALS 5874 POS_PAGEREFS 6018 POS_SEARCHWORDS 6209 POS_KEYWORDS 6361 POS_MISC 2381 POS_ERRORS 6420 POS_CLUSTER 3476 POS_SIDER_404 6566 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20230801102812 1 0 17942945239947 FirstTime 20230702124007 LastTime 20230729132613 LastUpdate 20230801180956 1 0 0 0 0 TotalVisits 62 TotalUnique 11 MonthHostsKnown 0 MonthHostsUnknown 11 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 DirectorSupport 0 0 0 QuickTimeSupport 0 0 0 AddToFavourites 0 188 0 TotalMisc 0 0 0 FlashSupport 0 0 0 JavascriptDisabled 0 0 0 RealPlayerSupport 0 0 0 JavaEnabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 PDFSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 0 0 0 0 0 0 2 0 0 0 1 1 226 3 2 2 18264 0 0 0 4 0 0 0 0 0 0 5 0 0 0 0 0 0 6 6 15 540534 0 0 0 7 0 0 0 0 0 0 8 2 2 18264 0 0 0 9 46 290 2181076 4 6 0 10 576 1287 3536219 10 12 0 11 1128 2616 33325512 13 29 0 12 929 1660 17308152 12 28 322 13 786 1295 26345704 9 15 1924 14 1039 1183 13489185 9 51 492 15 1342 1722 14443548 8 10 322 16 2148 2942 36208053 36 104 38348 17 1097 1446 22031781 9 43 0 18 0 0 0 0 0 0 19 0 0 0 2 2 71824 20 0 0 0 0 0 0 21 0 0 0 0 0 0 22 0 0 0 0 0 0 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 in 6743 12091 166671326 us 2356 2367 2756702 be 2 2 18264 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 1 no_user_agent 2 71824 20230712193728 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 14 gif 27 151962 0 0 js 4110 30624241 0 0 css 680 4133568 0 0 woff2 100 2861844 0 0 png 215 10412992 0 0 ttf 16 39240 0 0 svg 95 287588 0 0 jpeg 6 61374 0 0 jpg 188 35618473 0 0 php 6811 52613540 0 0 html 1039 27284430 0 0 Unknown 1072 4212824 0 0 woff 63 373628 0 0 webp 38 770588 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 4 android10 141 12 win10 11949 6723 Unknown 2356 2354 linux 14 12 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 6 mozilla 8 6 chrome108.0.0.0 2 2 Unknown 2348 2348 chrome84.0.4147.105 13 4 chrome114.0.0.0 6243 3188 chrome115.0.0.0 5846 3553 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 4 WordPress/6.2.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230729132613 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20230705093236 WhatsApp/2.23.13.76_A 20230718161414 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20230704030647 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 2 WhatsApp/2.23.13.76_A 20230718161414 WordPress/6.2.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230729132613 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 2372 2381 From1 0 0 From2 0 0 From3 60 60 From4 6669 12019 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 1 https://md-in-74.webhostbox.net:2083 60 60 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 7 400 1 0 406 1 226 503 6 2148 421 2 644 302 93 38281 404 6 335 301 2 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 1 /wp-admin/admin-ajax.php 6 https://testsahyadrimahavidyalay.ptechinstitute.com/wp-admin/customize.php END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 11 115.96.208.162 6706 11922 160464508 20230729132613 216.10.248.154 2346 2346 2171402 20230729132613 49.32.148.31 16 68 2289615 20230727113647 117.223.173.225 11 11 67157 20230718161414 49.32.130.255 6 85 3827663 20230718171359 35.212.26.22 4 13 522270 20230703065131 117.223.173.178 4 5 22383 20230706120209 164.92.174.142 2 2 18264 20230712084931 87.236.176.95 2 2 18264 20230704030647 162.142.125.13 2 3 22383 20230702124007 167.248.133.184 2 3 22383 20230705093231 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 21 20230702 16 17 131967 3 20230703 6 15 540534 2 20230704 2 2 18264 1 20230705 5 6 40647 2 20230706 7 8 40647 2 20230707 23 130 1920366 2 20230711 2 2 18264 1 20230712 2 2 18264 1 20230713 742 1129 14240347 4 20230714 936 1341 32692187 4 20230715 715 1164 19706126 2 20230716 1029 1417 17469797 6 20230718 205 614 11035487 7 20230719 106 389 4579269 2 20230721 2340 3074 22966890 2 20230722 1666 2039 18458894 4 20230725 643 1315 14093651 2 20230726 83 364 1047253 6 20230727 422 941 8716170 5 20230728 15 142 294743 2 20230729 136 349 1416525 2 END_DAY # Session range - Number of visits BEGIN_SESSION 7 2mn-5mn 3 0s-30s 19 15mn-30mn 3 30s-2mn 1 5mn-15mn 6 30mn-1h 8 1h+ 22 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 112 /wp-admin/admin-ajax.php 4023 7191601 6 17 /wp-cron.php 2233 0 24 20 / 735 20314772 13 21 /wp-json/jetpack/v4/jitm 342 8134 0 0 /wp-admin/post.php 164 20014671 0 0 /wp-json/wp/v2/block-patterns/categories 68 43996 0 0 /wp-json/wp/v2/blocks 68 1496 0 0 /wp-json/wp/v2/themes 68 106827 0 0 /wp-json/wp/v2/users 68 3060 0 0 /wp-json/wp/v2/block-patterns/patterns 68 3608054 0 0 /wp-json/ 68 21152 0 0 /wp-json/wp/v2/taxonomies 68 168640 0 0 /wp-admin/edit.php 58 2593123 0 0 /wp-admin/load-scripts.php 58 2724579 0 0 /elementor-hf/header/ 54 1201754 0 0 /wp-admin/nav-menus.php 51 2940218 0 0 /wp-json/elementor/v1/kit-elements-defaults 44 968 0 0 /wp-json/elementor/v1/globals 44 11132 0 0 /wp-admin/ 42 2077509 16 0 /wp-admin/load-styles.php 37 5285118 0 0 /about/ 36 956092 0 1 /wp-admin/post-new.php 36 4045378 0 0 /wp-admin/admin.php 34 2409010 0 0 /wp-admin/themes.php 32 1555435 0 0 /wp-admin/async-upload.php 31 20868 0 0 /wp-json/wp/v2/pages/247 2 2994 0 0 /wp-json/wp/v2/pages/347 2 2993 0 0 /wp-includes/js/tinymce/skins/lightgray/fonts/tinymce.woff 8 94120 0 0 /wp-admin/profile.php 1 0 0 0 /wp-json/wp/v2/pages/218 2 2991 0 0 /wp-json/contact-form-7/v1/contact-forms/322/feedback/schema 2 332 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsjZ0B4kaVQUwaEQXjN_mQ.woff 6 36384 0 0 /wp-json/wp/v2/widget-types 2 2006 0 0 /wp-json/wp/v2/pages/52 3 5343 0 0 /wp-json/wp/v2/pages/215 2 2985 0 0 /wp-json/wp/v2/pages/221 2 2989 0 0 /wp-json/elementor/v1/send-event 15 360 0 0 /wp-json/omapp/v1/notifications 13 3107 0 0 /wp-json/contact-form-7/v1/contact-forms/322/refill 1 22 0 0 /wp-json/wp/v2/pages/300 2 2986 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-solid-900.woff2 5 234804 0 0 /wp-content/plugins/smart-slider-3/Public/SmartSlider3/Application/Admin/Assets/fonts/SmartSliderIcons.woff2 5 98368 0 0 /wp-json/wp/v2/pages/239 2 2990 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-brands-400.woff2 1 76736 0 0 /contact-us/ 24 737472 0 0 /wp-json/wp/v2/pages/259 3 5345 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsg-1x4kaVQUwaEQXjN_mQ.woff 6 35136 0 0 /wp-json/wp/v2/pages/244 2 2992 0 0 /staff-list/ 2 48734 0 0 /wp-admin/plugin-install.php 6 204419 0 0 /wp-json/wp/v2/pages/343 2 3001 0 0 /wp-content/plugins/header-footer-elementor/assets/fonts/hfe.ttf 16 39240 0 0 /wp-admin/upload.php 1 47414 0 0 /wp-admin/index.php 1 51297 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsiH0B4kaVQUwaEQXjN_mQ.woff 6 36208 0 0 /wp-json/wp/v2/pages/250 3 5347 0 0 /wp-json/wp/v2/pages/350 3 5372 0 0 /wp-json/wp/v2/pages/230 2 2991 0 0 /wp-content/fonts/poppins/pxiByp8kv8JHgFVrLGT9Z1xlE92JQEk.woff 17 51860 0 0 /english/ 2 48870 0 0 /wp-content/plugins/smart-slider-3/Public/SmartSlider3/Application/Admin/Assets/fonts/Inter-SemiBold.woff2 8 574728 0 0 /wp-json/wp/v2/pages/224 2 2992 0 0 /wp-content/plugins/elementor/assets/lib/eicons/fonts/eicons.woff2 22 565488 0 0 /wp-content/plugins/wpforms-lite/assets/images/integrations/elementor/font/icon-wpforms.woff2 11 18424 0 0 /wp-admin/about.php 12 447736 2 0 /wp-admin/theme-install.php 5 173127 0 0 /wp-content/fonts/lato/S6u9w4BMUTPHh6UVSwiPGQ.woff2 6 69120 0 0 /examination-result/ 4 129596 0 1 /faculties/ 10 304500 0 0 /wp-json/wp/v2/pages/294 2 2999 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-regular-400.woff2 1 13224 0 0 /wp-admin/customize.php 14 2344006 0 0 /wp-content/fonts/ubuntu/4iCv6KVjbNBYlgoCxCvjsGyN.woff2 1 29752 0 0 /category/uncategorized/ 2 18502 0 1 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-regular-400.woff2 7 53104 0 1 /wp-json/wp/v2/pages/71 3 5353 0 0 /wp-content/plugins/smart-slider-3/Public/SmartSlider3/Application/Admin/Assets/fonts/Inter-Medium.woff2 5 381024 0 0 /wp-admin/plugins.php 13 563229 0 0 /wp-json/wp/v2/taxonomies/category 30 27420 0 0 /wp-json/wp/v2/pages/233 2 2987 0 0 /wp-json/wp/v2/pages/265 2 2990 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.woff2 18 390980 0 0 /wp-json/wp/v2/pages/353 2 3006 0 0 /wp-json/wp/v2/pages/253 2 2993 0 0 /wp-json/wp/v2/pages/6 22 51766 0 0 /2023/06/07/hello-world/ 2 21552 1 0 /wp-json/wp/v2/pages/56 2 2993 0 0 /academics/ 16 497990 0 0 /wp-json/wp/v2/categories/1 30 8640 0 0 /wp-json/wp/v2/pages/8 6 12418 0 0 /principle-message/ 20 527847 0 0 /wp-json/wp/v2/pages/64 5 10055 0 0 /wp-json/wp/v2/pages/227 2 2994 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.woff2 3 153528 0 0 /wp-json/wp/v2/taxonomies/post_tag 30 25620 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsg-1x4gaVQUwaEQXjM.woff 2 33440 0 0 /wp-content/themes/advance-training-academy/webfonts/fa-solid-900.woff2 1 38784 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsjZ0B4gaVQUwaEQXjM.woff 18 86480 0 0 /wp-json/wp/v2/pages/54 2 2989 0 0 /wp-json/contact-form-7/v1/contact-forms/322 11 12927 0 0 /wp-content/fonts/ubuntu/4iCs6KVjbNBYlgoKfw72.woff2 1 34852 0 0 /wp-json/wp/v2/pages/297 3 5356 0 0 /wp-content/plugins/bellows-accordion-menu/assets/css/fontawesome/fonts/fontawesome-webfont.woff2 5 128928 0 0 /wp-login.php 1 2311 0 0 /elementor-hf/footer/ 12 230762 0 0 /home/ 10 147326 0 0 /wp-json/wp/v2/pages/303 2 3005 0 0 /wp-json/wp/v2/pages/236 2 2990 0 0 /wp-json/wp/v2/pages/356 1 2353 0 0 /wp-json/wp/v2/pages/256 2 2994 0 0 /wp-json/contact-form-7/v1/contact-forms/322/feedback 1 182 0 0 /wp-json/wp/v2/pages/262 3 5349 0 0 END_SIDER