AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202407 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2048 POS_TIME 2723 POS_VISITOR 9854 POS_DAY 12259 POS_DOMAIN 3413 POS_LOGIN 3811 POS_ROBOT 3966 POS_WORMS 4271 POS_EMAILSENDER 4402 POS_EMAILRECEIVER 4545 POS_SESSION 12873 POS_SIDER 13030 POS_FILETYPES 4680 POS_DOWNLOADS 4858 POS_OS 4906 POS_BROWSER 5153 POS_SCREENSIZE 5628 POS_UNKNOWNREFERER 5702 POS_UNKNOWNREFERERBROWSER 6261 POS_ORIGIN 6628 POS_SEREFERRALS 6765 POS_PAGEREFS 6909 POS_SEARCHWORDS 7057 POS_KEYWORDS 7209 POS_MISC 2387 POS_ERRORS 7268 POS_CLUSTER 3667 POS_SIDER_404 7381 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240801042343 5 1084 17530418739125 FirstTime 20240701011750 LastTime 20240731231310 LastUpdate 20240801183609 5 0 4 0 0 TotalVisits 73 TotalUnique 57 MonthHostsKnown 0 MonthHostsUnknown 60 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 AddToFavourites 0 0 0 QuickTimeSupport 0 0 0 JavaEnabled 0 0 0 DirectorSupport 0 0 0 JavascriptDisabled 0 0 0 TotalMisc 0 0 0 FlashSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 PDFSupport 0 0 0 RealPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 2 2 98294 48 48 17184 1 4 4 55912 50 52 44800 2 6 13 267752 0 0 0 3 0 0 0 36 42 13980 4 8 8 111824 56 56 116306 5 22 64 26517083 2 3 28447 6 6 7 84359 5 14 32110 7 8 8 252500 6 14 102590 8 10 12 351776 0 0 0 9 11 12 294925 1 1 226 10 7 7 308860 3 3 942 11 4 4 196588 52 52 116194 12 6 8 86097 4 6 98460 13 2 3 28447 2 2 166 14 6 6 83868 0 31 11098 15 6 8 156435 0 2 0 16 6 7 84359 2 2 452 17 4 5 56403 13 13 102100 18 4 4 55912 36 51 17335 19 6 8 226773 1 1 226 20 2 3 28447 4 5 126741 21 13 55 26320943 0 0 0 22 8 15 225370 10 18 6444 23 12 19 492296 0 8 2864 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 13 us 69 158 53529241 cn 28 55 734968 fr 24 24 1179528 ca 10 10 491470 in 8 8 111824 vn 6 6 83868 gb 4 4 55912 ru 4 4 55912 pa 2 2 27956 zz 2 3 28447 lv 2 2 27956 sc 2 2 27956 be 2 4 30185 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 4 no_user_agent 10 491470 20240729112904 0 scanner 9 85341 20240702201441 0 Go\-http\-client/ 5 29163 20240708184445 0 (firefox/)([0-9]\.|[0-1][0]\.) 2 98294 20240701045249 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 6 png 19 13070 0 0 html 153 3897084 0 0 js 30 565275 0 0 css 18 266046 0 0 jpg 52 50567756 0 0 woff2 10 1075992 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 12 win10 21 20 macosx 24 6 macosx15 57 47 linuxubuntu 24 24 androidnougat 2 2 androidkitkat 4 4 androidcupcake 2 2 androidpie 2 2 Unknown 28 22 linux 108 24 macosx14 4 4 android10 6 6 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 20 chrome74.0.3729.157 2 2 chrome122.0.0.0 6 6 mozilla 12 6 Unknown 16 16 chrome68.0.3440.91 2 2 chrome96.0.4664.45 2 2 android 6 6 chrome92.0.4515.131 2 2 chrome100.0.4896.60 10 10 chrome124.0.0.0 2 2 chrome117.0.0.0 12 12 chrome126.0.0.0 3 2 chrome76.0.3809.111 2 2 firefox115.0 24 24 chrome76.0.3809.110 2 2 chrome121.0.0.0 116 32 chrome87.0.4280.88 24 6 chrome76.0.3809.87 2 2 chrome116.0.0.0 3 3 chrome96.0.4664.110 34 24 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 3 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20240720190843 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240716050257 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20240704151424 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240716050257 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 153 169 From1 0 0 From2 0 0 From3 0 0 From4 10 113 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 3 406 40 9040 404 349 124942 409 5 415 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 95 /.kube/config 2 - /php_info.php 2 - /site/.git/config 4 - /config.yaml 2 - /tool/view/phpinfo.view.php 4 - /config.yml 2 - /login/.git/config 4 - //ajax.googleapis.com/ajax/libs/jquery/3.6.3/jquery.min.js 9 - /htdocs/.git/config 4 - /.git-credentials 4 - /env.js 2 - /.env.production 6 - /.env_1 4 - /wp-content/themes/.git/config 4 - /.env.dev 6 - /_profiler/phpinfo.php 2 - /vendor/php-email-form/validate.js 9 - /cacti/cmd_realtime.php 2 - /backup.zip 1 - /dev/.git/config 4 - /wp-content/plugins/.git/config 4 - /env.dev.js 2 - /back/.git/config 4 - /wp-content/.git/config 4 - /assets/.git/config 4 - /.env.live 4 - /config.xml 2 - /phpinfo.php 4 - /vendor/.git/config 4 - /docker-compose.yml 6 - /env.production.js 2 - /wiki/.git/config 4 - /debug/default/view 2 - /js/main.js 9 - /.env.www 4 - /home/.git/config 4 - /.env.save 4 - /codebuild.yml 4 - /config.json 1 - /.aws_credentials.json 1 - //maxcdn.bootstrapcdn.com/bootstrap/3.4.1/js/bootstrap.min.js 9 - /.git/config 18 - /.env.stage 4 - /www/.git/config 4 - /info.php 2 - /s3/.git/config 4 - /.svn/wc.db 2 - /web/.git/config 4 - /env.development.js 2 - /index/.git/config 4 - /.env.dev.local 4 - /.env.example 2 - /Dockerrun.aws.json 1 - /app/.git/config 4 - /backup.tar.gz 1 - /.aws/credentials 4 - /ui/..%5Csrc%5CgetSettings.rsb 2 - /http/.git/config 4 - /admin/.env 2 - /env.test.js 2 - /secrets.json 1 - /appointment.php 2 - /vendor/bootstrap/js/bootstrap.bundle.min.js 9 - /admin/.git/config 4 - /info 2 - /backend/.git/config 4 - /.ssh/id_ecdsa 2 - /vendor/glightbox/js/glightbox.min.js 9 - /linusadmin-phpinfo.php 2 - /dashboard/phpinfo.php 2 - /api/.git/config 4 - /wp-config.php 4 - /.env.production.local 4 - /config/database.php 2 - /.env.local 4 - /_profiler/phpinfo 2 - /.env.development.local 4 - /css/.git/config 4 - /env.prod.js 2 - /sendgrid.env 2 - /config/production.json 1 - /git/.git/config 4 - /phpinfo 2 - /.env_sample 4 - /config.php 2 - /vendor/purecounter/purecounter_vanilla.js 9 - /wp-admin/setup-config.php 1 - /feed 2 - /.env.prod 4 - /.ssh/id_ed25519 2 - /var/.git/config 4 - /.git/HEAD 2 - /vendor/swiper/swiper-bundle.min.js 8 - /server.key 2 - /.env.prod.local 4 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 60 52.87.44.246 14 98 52192798 20240721215021 36.99.136.137 10 19 221779 20240726022847 45.148.10.59 8 8 111824 20240730221727 171.244.43.14 6 6 83868 20240701210338 36.99.136.128 6 7 84359 20240718225138 54.88.179.33 6 6 294882 20240731231310 35.171.144.152 4 4 196588 20240717102916 36.99.136.136 4 19 316024 20240718225140 104.164.173.67 4 4 55912 20240701041712 36.99.136.129 4 4 55912 20240727062836 154.28.229.160 4 4 55912 20240701050805 79.137.248.15 3 3 41934 20240730090429 104.164.173.54 3 3 41934 20240701050804 198.235.24.206 2 2 98294 20240710082016 154.28.229.156 2 2 27956 20240701164747 165.232.153.228 2 2 27956 20240705054804 45.196.45.135 2 2 27956 20240708184444 157.245.10.85 2 2 27956 20240722144358 198.235.24.226 2 2 98294 20240705152000 128.199.29.194 2 2 27956 20240717172315 51.254.49.98 2 2 98294 20240712110341 23.145.40.147 2 3 28447 20240707095146 205.210.31.75 2 2 98294 20240716050257 185.81.128.21 2 2 27956 20240725224851 167.94.138.38 2 4 30185 20240704151410 87.236.176.131 0 1 491 87.236.176.244 0 1 1738 18.139.115.239 2 2 27956 20240708145453 123.160.223.75 2 2 27956 20240731081052 64.227.151.223 2 3 28447 20240731173350 205.210.31.96 2 2 98294 20240705085649 147.185.132.108 2 2 98294 20240716005432 51.254.49.100 2 2 98294 20240704214503 188.165.87.107 2 2 98294 20240726055305 188.165.87.98 2 2 98294 20240726054723 147.185.132.171 2 2 98294 20240703234722 154.28.229.5 2 2 27956 20240701041706 179.43.167.18 2 2 27956 20240701062635 188.165.87.103 2 2 98294 20240712075710 123.160.223.74 0 1 491 87.236.176.176 2 2 27956 20240720190842 51.254.49.105 2 2 98294 20240726090927 188.165.87.111 2 2 98294 20240712075240 15.236.225.192 2 2 27956 20240729012841 159.203.42.15 2 2 27956 20240708142306 209.97.133.131 2 2 27956 20240705121856 111.7.96.179 2 3 28447 20240729204507 188.165.87.104 2 2 98294 20240704192110 162.142.125.220 2 4 30185 20240701120133 51.254.49.110 2 2 98294 20240704211329 51.254.49.107 2 2 98294 20240726080014 161.35.239.93 2 2 27956 20240701124433 85.192.41.110 1 1 13978 20240731162029 165.227.68.9 2 2 27956 20240703071615 192.34.56.243 2 2 27956 20240703091449 198.235.24.136 2 2 98294 20240710090419 51.254.49.106 2 2 98294 20240712115949 147.185.132.51 2 2 98294 20240702100023 188.165.87.105 2 2 98294 20240704192112 167.172.39.141 2 2 27956 20240701064752 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 25 20240701 29 31 407591 12 20240702 2 2 98294 1 20240703 6 6 154206 3 20240704 12 15 451808 6 20240705 9 9 266478 5 20240706 7 49 26096399 1 20240707 4 5 56403 2 20240708 6 6 83868 3 20240710 4 4 196588 2 20240711 2 3 28447 1 20240712 10 11 421623 5 20240714 2 2 27956 1 20240716 4 4 196588 2 20240717 8 8 322838 3 20240718 4 11 169458 2 20240719 1 1 13978 1 20240720 6 15 199643 2 20240721 7 49 26096399 1 20240722 2 2 27956 1 20240725 2 2 27956 1 20240726 14 21 590590 7 20240727 4 5 56403 2 20240729 6 7 84359 3 20240730 3 3 41934 2 20240731 9 11 267460 4 END_DAY # Session range - Number of visits BEGIN_SESSION 2 30s-2mn 1 0s-30s 72 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 6 / 153 3897084 73 71 /assets/vendor/boxicons/fonts/boxicons.woff2 2 231360 0 0 /assets/vendor/bootstrap-icons/fonts/bootstrap-icons.woff2 2 242592 0 0 /assets/vendor/fontawesome-free/webfonts/fa-regular-400.woff2 2 50472 0 1 /assets/vendor/remixicon/remixicon.woff2 2 250536 0 1 /assets/vendor/fontawesome-free/webfonts/fa-solid-900.woff2 2 301032 0 0 END_SIDER