AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202407 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2693 POS_VISITOR 8643 POS_DAY 8938 POS_DOMAIN 3381 POS_LOGIN 3635 POS_ROBOT 3790 POS_WORMS 4142 POS_EMAILSENDER 4273 POS_EMAILRECEIVER 4416 POS_SESSION 9209 POS_SIDER 9346 POS_FILETYPES 4551 POS_DOWNLOADS 4634 POS_OS 5379 POS_BROWSER 5524 POS_SCREENSIZE 5748 POS_UNKNOWNREFERER 5822 POS_UNKNOWNREFERERBROWSER 6163 POS_ORIGIN 6245 POS_SEREFERRALS 6375 POS_PAGEREFS 6538 POS_SEARCHWORDS 6686 POS_KEYWORDS 6838 POS_MISC 2356 POS_ERRORS 6897 POS_CLUSTER 3491 POS_SIDER_404 7032 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240801111916 4 798 8964363499312 FirstTime 0 LastTime 0 LastUpdate 20240801183615 4 0 3 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 9 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 PDFSupport 0 0 0 JavascriptDisabled 0 0 0 AddToFavourites 0 12 0 TotalMisc 0 0 0 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 QuickTimeSupport 0 0 0 RealPlayerSupport 0 0 0 DirectorSupport 0 0 0 JavaEnabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 1 62444 39 54 1000633 1 0 0 0 69 78 2305736 2 0 1 42015 74 82 3059287 3 0 0 0 72 79 1952521 4 0 0 0 6 13 256583 5 0 0 0 33 40 918957 6 0 0 0 33 38 893304 7 0 0 0 68 68 1812810 8 0 3 1860631 74 83 1843730 9 0 0 0 37 40 902548 10 0 1 77381 132 142 3758565 11 0 2 246338 72 84 1902367 12 0 0 0 70 76 898056 13 0 0 0 4 9 246 14 0 0 0 2 10 738 15 0 1 65253 91 100 2097973 16 0 4 659663 66 73 2503008 17 0 0 0 74 81 2791168 18 0 0 0 14 16 445259 19 0 0 0 10 19 1190 20 0 1 77381 68 70 1772128 21 0 0 0 2 13 85014 22 0 0 0 45 56 4153946 23 0 1 42015 41 51 1155723 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 jp 0 1 77381 us 0 9 1498388 in 0 5 1557352 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 5 Googlebot/ 124 1077988 20240731201509 86 Go\-http\-client/ 118 38648 20240730115410 0 bingbot/ 25 471199 20240731114648 15 bot[\s_+:,\.\;\/\\-] 14 1247215 20240725115544 8 facebookexternalhit/ 6 3591022 20240714171201 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 pdf 15 3133121 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 10 /wp-content/uploads/2024/01/Faculty-Profile.pdf 8 0 336120 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 7 0 6283823 /wp-content/uploads/2024/01/Tejasvi-Bhandari-madam-FACULTY-PROFILE.pdf 5 0 831425 /wp-content/uploads/2024/01/Academic-Calender-2018-19.pdf 4 0 261012 /wp-content/uploads/2024/01/Academic-Calender-2022-23.pdf 4 0 309524 /wp-content/uploads/2024/02/Marathi-Dr-Dipti-Shembekar-FACULTY-PROFILE.pdf 3 0 506871 /wp-content/uploads/2024/01/Academic-Calender-2020-21.pdf 2 0 124888 /wp-content/uploads/2024/01/Academic-Calender-2019-20.pdf 2 0 142786 /wp-content/uploads/2024/01/Academic-Calender-2021-22.pdf 1 0 72071 /wp-content/uploads/2024/01/Kadam-P.A.pdf 1 0 282406 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 6 win10 1 0 android 1 0 androidmarshmallow 2 0 android10 3 0 win7 4 0 Unknown 4 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 8 chrome126.0.0.0 2 0 chrome109.0.0.0 1 0 opera83.0.0.0 1 0 firefox115.0 4 0 chrome125.0.6422.175 3 0 chrome87.0.4280.141 1 0 chrome126.0.6478.126 2 0 chrome126.0.6478.182 1 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/125.0.6422.175_Safari/537.36 20240712151103 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/126.0.6478.126_Safari/537.36 20240720111415 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 7 From1 0 0 From2 0 2 From3 0 0 From4 0 6 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 1 www_google_com 0 2 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 302 8 0 404 744 30073888 409 30 2490 406 40 9040 301 254 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 59 /dev/.git/config 2 - /.env.dev.local 2 - /codebuild.yml 4 - /s3/.git/config 2 - /.env.prod.local 2 - /assets/.git/config 2 - /.env.local 2 - /wp-content/plugins/.git/config 2 - /.env_1 2 - /.env_sample 2 - /v2/_catalog 58 - /wiki/.git/config 2 - /web/.git/config 2 - /env.production.js 1 - /.vscode/sftp.json 29 - /s/730323e2834323e20313e2631323/_/ 58 - /.DS_Store 60 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 58 - /app/.git/config 2 - /login.action 58 - /.env.stage 2 - /back/.git/config 2 - /css/.git/config 2 - /site/.git/config 2 - /.env.www 2 - /index/.git/config 2 - /debug/default/view 58 - /.env.prod 2 - /home/.git/config 2 - /env.js 1 - /env.development.js 1 - /htdocs/.git/config 2 - /wp-content/.git/config 2 - /vendor/.git/config 2 - /api/.git/config 2 - /env.dev.js 1 - /var/.git/config 2 - /server 58 - /config.json 29 - /telescope/requests 58 - /admin/.git/config 2 - /_all_dbs 58 - /http/.git/config 2 - /docker-compose.yml 4 - /www/.git/config 2 - /.env.dev 2 - /login/.git/config 2 - /env.test.js 1 - /.env.production 2 - /.env.development.local 2 - /.env.production.local 2 - /env.prod.js 1 - /wp-content/themes/.git/config 2 - /.env.save 2 - /.git/config 68 - /.env.live 2 - /backend/.git/config 2 - /git/.git/config 2 - /.git-credentials 4 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 9 49.36.179.91 0 4 659663 152.57.37.199 0 1 897689 66.249.68.38 0 1 42015 152.59.12.107 0 1 62444 152.57.222.33 0 1 77381 66.249.68.37 0 4 341478 157.119.176.78 0 1 77381 66.249.73.77 0 1 77381 49.44.83.7 0 1 897689 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 10 20240702 0 1 42015 0 20240704 0 1 77381 0 20240706 0 4 659663 0 20240711 0 1 65253 0 20240712 0 1 65253 0 20240716 0 1 77381 0 20240720 0 1 168957 0 20240724 0 1 62444 0 20240725 0 1 42015 0 20240731 0 3 1872759 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER