AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202507 will be lost/reset. # Last config file used to build this data file was /home/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2081 POS_TIME 2759 POS_VISITOR 8386 POS_DAY 9899 POS_DOMAIN 3363 POS_LOGIN 3689 POS_ROBOT 3844 POS_WORMS 4062 POS_EMAILSENDER 4193 POS_EMAILRECEIVER 4336 POS_SESSION 10292 POS_FILESIZE 10528 POS_SIDER 10449 POS_FILETYPES 4471 POS_DOWNLOADS 4583 POS_OS 4631 POS_BROWSER 4845 POS_SCREENSIZE 5284 POS_UNKNOWNREFERER 5358 POS_UNKNOWNREFERERBROWSER 5825 POS_ORIGIN 6063 POS_SEREFERRALS 6195 POS_PAGEREFS 6339 POS_SEARCHWORDS 6487 POS_KEYWORDS 6639 POS_MISC 2423 POS_ERRORS 6698 POS_CLUSTER 3545 POS_SIDER_404 6810 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250801015959 27 4306 11232786952848 FirstTime 20250701012315 LastTime 20250731121554 LastUpdate 20250801081543 27 0 26 0 0 TotalVisits 40 TotalUnique 38 MonthHostsKnown 0 MonthHostsUnknown 38 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 RealPlayerSupport 0 0 0 TotalMisc 0 0 0 PDFSupport 0 0 0 JavascriptDisabled 0 0 0 FlashSupport 0 0 0 DirectorSupport 0 0 0 QuickTimeSupport 0 0 0 AddToFavourites 0 4 0 JavaEnabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 2 2 894 5 7 0 1 3 3 28403 26 43 2235 2 5 7 45057 6 18 4385 3 9 10 157610 31 36 106433 4 5 5 1788 4 7 1432 5 4 4 28850 11 11 3580 6 0 1 491 8 8 2864 7 0 0 0 9 11 3537 8 1 1 447 5 6 1432 9 6 6 2682 19 34 0 10 2 2 894 9 12 2733 11 8 8 3576 2 12 0 12 2 2 894 7 12 2567 13 0 0 0 11 11 3806 14 1 1 447 5 6 1788 15 0 0 0 22 38 0 16 1 1 447 2 2 0 17 6 6 100082 0 5 0 18 2 2 27956 5 34 10827 19 0 0 0 0 5 0 20 2 2 894 1 2 0 21 2 2 894 39 58 7647 22 1 1 447 1 2 447 23 0 0 0 8 11 2682 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 9 us 39 42 185208 ca 5 5 2235 ru 5 5 28850 de 3 3 28403 gb 3 3 27956 za 2 2 894 zz 2 3 30466 rs 2 2 98294 in 1 1 447 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 bot[\s_+:,\.\;\/\\-] 52 23244 20250731215604 0 no_user_agent 5 99635 20250727021651 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 3 js 1 2510 0 0 png 3 2720 0 0 html 62 397523 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 10 symbian 2 2 macosx15 1 0 androidmarshmallow 2 2 ios_iphone 2 2 androidnougat 1 1 Unknown 33 31 linux 5 5 linuxubuntu 2 2 androidpie 1 1 win10 17 16 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 21 chrome76.0.3809.111 1 1 chrome31.0.1650.63 1 1 chrome52.0.3624.98 2 2 netscape5.0 2 2 chrome133.0.0.0 3 2 Unknown 6 6 firefox121.0 1 1 mozilla 25 23 firefox124.0 1 1 chrome64.0.3282.137 1 1 chrome137.0.0.0 4 4 chrome121.0.0.0 2 2 nokia 2 2 chrome77.0.3835.0 1 1 safari 1 1 chrome58.0.3029.110 1 1 firefox137.0 1 1 firefox134.0 2 2 chrome120.0.0.0 5 4 chrome108.0.0.0 3 3 safari14.0.3 1 1 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 4 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20250730164101 Hello_from_Palo_Alto_Networks,_find_out_more_about_our_scans_in_https://docs-cortex.paloaltonetworks.com/r/1/Cortex-Xpanse/Scanning-activity 20250730100607 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20250731121554 Mozilla/5.0_zgrab/0.x 20250726171827 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Hello_from_Palo_Alto_Networks,_find_out_more_about_our_scans_in_https://docs-cortex.paloaltonetworks.com/r/1/Cortex-Xpanse/Scanning-activity 20250730100607 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 62 66 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 3 409 6 498 404 276 29714 406 22 4972 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 54 /js/main.js 4 - /wiki 2 - //ajax.googleapis.com/ajax/libs/jquery/3.6.3/jquery.min.js 4 - /js/config.js 4 - /firebase-config.js 4 - /assets/env.js 4 - /sendgrid.env 4 - /.git/HEAD 16 - /robots.txt 31 - /runtime-env.js 4 - /assets/settings.js 4 - /backend/.env 4 - /_all_dbs 2 - /.env.save 4 - /vendor/bootstrap/js/bootstrap.bundle.min.js 3 - /assets/vendor/swiper/swiper-bundle.min.js.map 2 - /application/.env 4 - /sitemap.xml 1 - /vendor/php-email-form/validate.js 4 - /credentials.json 4 - /vendor/glightbox/js/glightbox.min.js 4 - /settings.js 4 - /.env.example 4 - /js/env.js 4 - /admin/.env 4 - /php_info.php 4 - /aws-exports.js 4 - /assets/vendor/bootstrap/js/bootstrap.bundle.min.js.map 2 - /phpinfo.php 4 - //maxcdn.bootstrapcdn.com/bootstrap/3.4.1/js/bootstrap.min.js 4 - /info 4 - /api/.env 4 - /.well-known/security.txt 2 - / 4 - /login 1 - /js/app.js 4 - /config.json 4 - /assets/vendor/purecounter/purecounter_vanilla.js.map 2 - /.git/config 42 - /env.js 4 - /.env.prod 4 - /secrets.json 4 - /vendor/purecounter/purecounter_vanilla.js 4 - /manifest.json 4 - /.env 6 - /phpinfo 4 - /assets/config.js 4 - /js/settings.js 4 - /_profiler/phpinfo 4 - /config.js 4 - /app-settings.js 4 - /firebase.js 4 - /vendor/swiper/swiper-bundle.min.js 4 - /dev/.env 4 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 38 18.191.145.83 5 5 2235 20250718094806 199.45.155.84 4 4 1788 20250731115603 206.168.34.219 3 5 44163 20250703021401 167.94.138.126 2 2 894 20250724205818 194.163.152.77 2 2 27956 20250701185145 162.142.125.122 2 2 894 20250731121554 206.189.2.13 2 2 98294 20250701033201 167.94.138.187 2 2 894 20250731114348 193.32.126.221 2 2 27956 20250701033353 167.94.146.54 2 2 894 20250731113528 170.39.218.62 2 3 30466 20250701012315 206.168.34.70 2 2 894 20250717022348 162.142.125.125 2 2 894 20250723114931 91.231.89.37 2 2 98294 20250701173516 195.211.77.142 2 2 27956 20250701033218 71.6.134.233 2 3 28447 20250701055544 196.251.88.59 2 2 894 20250726053856 206.168.34.222 2 2 894 20250725041329 195.211.77.140 1 1 0 20250701033158 213.209.143.116 1 1 447 20250729214139 146.190.18.43 1 1 447 20250730084322 45.148.10.80 1 1 447 20250720174458 147.185.132.84 1 1 447 20250725100339 35.160.88.114 1 1 447 20250729213146 185.247.137.180 1 1 447 20250710144329 18.224.192.118 1 1 447 20250715005241 185.247.137.217 1 1 447 20250730164101 198.235.24.197 1 1 447 20250718041933 64.226.83.184 1 1 447 20250715220911 198.235.24.245 1 1 447 20250730100607 35.94.177.95 1 1 447 20250730004131 205.210.31.79 1 1 447 20250717171045 35.90.170.126 1 1 447 20250709045613 159.65.149.186 1 1 447 20250721015739 205.210.31.101 1 1 447 20250715090201 205.210.31.237 1 1 447 20250714170517 3.146.111.124 1 1 447 20250726171827 146.70.185.32 1 1 0 20250701041232 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 17 20250701 16 17 336859 9 20250703 3 6 46673 1 20250709 1 1 447 1 20250710 1 1 447 1 20250714 1 1 447 1 20250715 3 3 1341 3 20250717 5 5 2235 3 20250718 6 6 2682 2 20250720 1 1 447 1 20250721 2 2 894 2 20250723 2 2 894 1 20250724 2 2 894 1 20250725 3 3 1341 2 20250726 2 2 894 2 20250729 2 2 894 2 20250730 4 4 1788 4 20250731 8 8 3576 4 END_DAY # Session range - Number of visits BEGIN_SESSION 2 30s-2mn 7 0s-30s 33 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 62 397523 40 40 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 7 5K+ 19 100-500 209 2K-5K 1 1K-2K 1 0-44 215 44-100 10 500-1K 2 END_FILESIZE