AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202308 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2725 POS_VISITOR 9888 POS_DAY 13953 POS_DOMAIN 3527 POS_LOGIN 3942 POS_ROBOT 4097 POS_WORMS 4530 POS_EMAILSENDER 4661 POS_EMAILRECEIVER 4804 POS_SESSION 14781 POS_SIDER 14992 POS_FILETYPES 4939 POS_DOWNLOADS 5278 POS_OS 5326 POS_BROWSER 5558 POS_SCREENSIZE 6157 POS_UNKNOWNREFERER 6231 POS_UNKNOWNREFERERBROWSER 7257 POS_ORIGIN 8028 POS_SEREFERRALS 8176 POS_PAGEREFS 8320 POS_SEARCHWORDS 8549 POS_KEYWORDS 8701 POS_MISC 2387 POS_ERRORS 8760 POS_CLUSTER 3798 POS_SIDER_404 8947 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20230901102926 42 8428 15352334244390 FirstTime 20230801102812 LastTime 20230831205154 LastUpdate 20230901181957 42 0 41 0 0 TotalVisits 229 TotalUnique 94 MonthHostsKnown 0 MonthHostsUnknown 100 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 FlashSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 DirectorSupport 0 0 0 PDFSupport 0 0 0 AddToFavourites 0 215 0 TotalMisc 0 0 0 RealPlayerSupport 0 0 0 JavaEnabled 0 0 0 JavascriptDisabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 6 6 439468 2 2 326984 1 13 14 622587 34 36 657104 2 0 0 0 0 0 0 3 35 71 1633244 101 106 1519304 4 18 128 2850596 3 14 1067 5 8 8 494988 0 0 0 6 27 184 3619733 0 7 54284 7 2 2 71044 0 0 0 8 27 63 949093 3 5 83 9 10 10 809252 31 35 1768 10 819 2459 24765695 22 45 258899 11 1739 2821 32868427 31 66 290970 12 2440 4026 57900569 68 224 3200114 13 1424 2084 12795638 41 74 561254 14 1581 2348 34300776 42 82 724711 15 1610 2096 23047734 44 63 74570 16 2155 3349 47049672 27 115 433623 17 1930 2587 30251372 43 68 477273 18 123 212 2285499 34 38 55813 19 12 13 621159 33 35 1508 20 37 161 5854587 31 47 554683 21 8 8 703836 33 33 328658 22 0 0 0 0 0 0 23 8 76 1183604 0 6 27391 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 13 in 10397 17628 228160457 us 3559 5020 51026934 ca 24 24 2894284 ru 12 12 284176 gb 8 8 543862 de 8 8 284176 be 8 10 296700 nl 4 4 732148 fr 4 4 611660 cn 2 2 71044 jp 2 2 71044 cz 2 2 71044 vn 2 2 71044 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 7 PhantomJS 98 1507099 20230829122451 0 Go\-http\-client/ 58 229798 20230831205157 0 no_user_agent 40 4870544 20230831205131 0 unknown 4 520 20230808094013 4 bot[\s_+:,\.\;\/\\-] 2 73402 20230830115356 0 archive\.org_bot 2 74588 20230815125357 0 (firefox/)([0-9]\.|[0-1][0]\.) 2 305830 20230808033923 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 13 woff2 198 6522588 0 0 jpg 300 58774283 0 0 css 1283 8163672 0 0 png 222 10969561 0 0 js 6699 36415715 0 0 gif 17 116986 0 0 ttf 32 2189400 0 0 html 2207 63461095 0 0 webp 52 1247652 0 0 php 8917 83594528 0 0 woff 192 1484776 0 0 Unknown 2486 11902679 0 0 svg 121 275638 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 11 android 6 6 android10 511 59 win10 18046 10454 linuxubuntu 95 9 macosx14 2 2 win7 32 0 win8.1 2 2 linux 588 68 Unknown 3422 3410 androidmarshmallow 20 20 macosx9 2 2 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 25 netscape5.0 8 8 firefox115.0 4 4 Unknown 3377 3376 chrome108.0.0.0 24 24 chrome79.0.3945.79 88 10 chrome63.0.3239.108 2 2 chrome99.0.4844.84 1 0 chrome109.0.5414.46 19 0 chrome103.0.5060.114 2 2 chrome115.0.5790.170 140 6 chrome110.0.0.0 127 6 chrome112.0.0.0 4 4 firefox83.0 2 2 chrome115.0.5790.98 84 7 chrome52.0.3624.98 20 20 chrome116.0.0.0 9589 5296 firefox62.0 2 2 chrome109.0.0.0 235 34 firefox114.0 91 5 mozilla 37 26 chrome84.0.4147.105 61 4 chrome115.0.0.0 8773 5190 chrome33.0.1750.152 2 2 chrome83.0.4103.61 32 0 chrome41.0.2226.0 2 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 10 Mozilla/5.0_researchscan.comsys.rwth-aachen.de 20230810190000 WordPress/6.3;_https://www.wpthemedetector.com 20230829122406 WordPress/6.2.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230809032634 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20230831201756 WordPress/6.3;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230830063301 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20230826190553 WordPress/6.2.2;_https://www.isitwp.com 20230829122436 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20230827165036 WordPress/6.3.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230831205154 WhatsApp/2.23.16.76_A 20230826160336 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 7 WhatsApp/2.23.16.76_A 20230826160336 WordPress/6.2.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230809032634 WordPress/6.3.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230831205154 WordPress/6.3;_https://www.wpthemedetector.com 20230829122406 WordPress/6.3;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230830063301 WordPress/6.2.2;_https://www.isitwp.com 20230829122436 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20230826190553 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 3569 3612 From1 0 0 From2 0 0 From3 148 150 From4 10315 18964 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 2 https://md-in-74.webhostbox.net:2083 148 148 https://www.wpthemedetector.com 0 2 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 10 400 1 21 405 1 0 301 375 538 404 83 2457096 409 66 5478 500 1 155 206 2 21244 503 1 358 302 135 0 406 15 3390 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 7 /wp-admin/admin-ajax.php 2 https://testsahyadrimahavidyalay.ptechinstitute.com/wp-admin/ /Public/home/js/check.js 2 https://www.testsahyadrimahavidyalay.ptechinstitute.com/Public/home/js/check.js /wp-content/uploads/2023/07/WhatsApp_Image_2023-07-18_at_18.34.33-removebg-preview-e1690266200260.png 75 https://testsahyadrimahavidyalay.ptechinstitute.com/chairmans-message/ /wp-content/themes/school-of-education/screenshot.png 1 - /static/admin/javascript/hetong.js 1 https://www.testsahyadrimahavidyalay.ptechinstitute.com/static/admin/javascript/hetong.js /wp-emoji-release.min.js 1 - /wp-content/themes/bizberg/screenshot.png 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 100 115.96.208.162 9788 15465 188161360 20230831173310 216.10.248.154 3350 3350 5016106 20230831205154 117.223.174.130 306 607 5863425 20230825124824 103.176.135.76 122 637 10786638 20230830160632 117.223.168.32 95 341 5424832 20230822181140 115.110.127.198 20 113 3810222 20230824100858 117.223.171.157 18 60 705197 20230820141932 152.57.118.214 14 59 750132 20230823205040 117.223.170.165 14 140 299469 20230823100622 89.175.184.250 12 12 284176 20230810102149 103.176.135.77 10 85 4478213 20230826161220 205.169.39.160 10 120 2636650 20230808041339 34.254.53.125 9 96 3546324 20230808063920 152.57.82.59 9 66 3297809 20230817105950 106.213.83.86 8 20 2719558 20230824165228 152.57.182.160 8 89 3209946 20230821140355 110.226.182.208 8 85 4730670 20230829124624 137.226.113.15 8 8 284176 20230810190000 152.57.215.132 8 69 3134034 20230820144746 192.0.91.199 7 84 4437164 20230829122432 152.57.230.165 6 84 3146685 20230820165140 152.57.40.230 6 49 1478351 20230813174149 110.227.27.116 6 73 1108345 20230824165152 152.57.61.145 5 40 73406 20230828030356 157.33.103.30 5 57 3975062 20230827110648 47.254.76.138 2 2 71044 20230808154138 198.235.24.70 2 2 322234 20230825201824 152.57.33.19 1 1 13276 20230828103637 183.129.153.157 2 2 71044 20230810232550 152.57.145.104 2 2 0 20230828202322 165.227.228.165 2 2 71044 20230811070412 198.235.24.65 2 2 313170 20230823145523 162.142.125.223 2 3 77525 20230827165025 66.75.51.6 0 61 495318 35.214.130.87 4 4 196294 20230829122406 167.248.133.38 2 3 75163 20230811081624 165.22.74.203 2 2 312952 20230823092228 142.93.50.86 2 2 74588 20230815145910 143.198.72.96 2 2 334460 20230816030138 167.99.1.18 2 2 71044 20230809082034 152.57.226.61 4 7 118896 20230820172715 167.94.145.57 2 3 83317 20230819030734 65.154.226.167 3 70 1029243 20230829115007 39.110.218.101 2 2 71044 20230808043818 152.57.41.211 5 41 74614 20230812134232 198.235.24.56 2 2 298072 20230812005523 167.248.133.191 2 3 75163 20230810010133 171.244.43.14 2 2 71044 20230808094014 87.236.176.145 0 1 4119 157.33.27.143 0 9 70139 167.99.8.63 2 2 316320 20230825130328 167.248.133.188 4 6 157414 20230813161138 143.110.218.229 2 2 328386 20230829031103 152.57.44.80 5 40 64150 20230828182647 161.35.27.144 2 2 313170 20230824140739 35.210.151.25 4 61 696882 20230815135516 152.57.42.177 5 41 1905 20230828103602 128.199.0.178 2 2 73388 20230829152309 35.188.13.186 0 1 5380 87.236.176.21 0 1 4119 152.57.54.202 5 69 3792684 20230811153803 65.154.226.171 3 70 1029243 20230829234935 152.57.170.79 2 2 57848 20230817122936 46.101.103.192 4 4 732148 20230831205139 38.132.193.74 0 79 582474 157.33.30.20 5 73 4292430 20230828200141 198.235.24.233 2 2 352900 20230819092222 165.22.229.73 2 2 71044 20230808183312 117.223.168.19 2 2 72528 20230824101046 198.235.24.81 2 2 326984 20230826190553 87.236.176.218 2 2 71018 20230805195511 152.57.182.91 5 40 0 20230830063248 167.172.232.142 2 2 328386 20230828013759 188.165.87.99 2 2 305830 20230810083416 152.57.174.190 5 40 73402 20230830145953 152.57.29.140 2 2 74588 20230812190349 167.248.133.33 2 3 83317 20230818230717 152.57.51.155 4 7 83380 20230812135705 152.57.77.22 2 2 72278 20230824172122 198.235.24.150 2 2 305830 20230808212252 198.235.24.136 2 2 334474 20230816112251 146.70.133.123 2 2 71044 20230808033911 51.254.49.102 2 2 305830 20230810121022 152.57.59.239 5 40 73388 20230829133846 47.242.105.176 4 4 142088 20230808181704 141.98.252.252 2 2 71044 20230808033913 152.57.51.85 5 40 0 20230829062246 162.142.125.13 2 3 75141 20230805141503 157.33.249.211 2 2 73274 20230826160336 164.90.222.93 2 2 305830 20230808033935 134.209.195.146 2 2 71044 20230810181508 198.235.24.180 2 2 352900 20230819050414 178.249.214.10 2 2 71044 20230808033902 152.57.7.2 2 2 57850 20230817122925 152.57.222.131 2 2 70614 20230821135340 164.92.84.255 2 2 326984 20230826213104 87.236.176.61 2 2 71044 20230809003324 167.94.145.53 2 3 76397 20230824201148 87.236.176.41 2 2 75378 20230831201753 87.236.176.232 2 2 71022 20230802210908 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 28 20230801 10 97 3544652 2 20230802 19 124 1634870 3 20230803 7 93 3472160 1 20230805 19 21 505388 5 20230806 112 230 1909241 2 20230808 60 397 8867042 19 20230809 10 10 284197 4 20230810 25 26 1255175 9 20230811 468 879 16767816 13 20230812 942 1487 20164456 8 20230813 14 59 1710353 5 20230815 14 71 920646 3 20230816 1676 2066 19166913 8 20230817 710 1260 20579863 11 20230818 710 994 10813772 7 20230819 985 1386 12772122 9 20230820 1285 1900 22542368 7 20230821 16 97 3351174 4 20230822 934 1636 24751163 9 20230823 845 1336 12538090 10 20230824 301 844 13470727 15 20230825 1020 1588 14355489 10 20230826 1435 1919 21513889 10 20230827 228 532 7479306 9 20230828 40 223 4990504 12 20230829 296 841 13882197 18 20230830 1197 1713 14692054 9 20230831 654 897 7182946 7 END_DAY # Session range - Number of visits BEGIN_SESSION 7 5mn-15mn 6 2mn-5mn 8 30s-2mn 12 1h+ 42 30mn-1h 11 15mn-30mn 10 0s-30s 140 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 239 /wp-admin/admin-ajax.php 4962 6849264 8 28 /wp-cron.php 3188 0 70 56 / 1502 45752464 111 96 /wp-json/jetpack/v4/jitm 423 9306 0 1 /wp-admin/edit.php 225 12418622 0 0 /wp-json/ 187 58905 0 0 /wp-json/wp/v2/blocks 187 4114 0 0 /wp-json/wp/v2/block-patterns/patterns 187 10048680 0 0 /wp-json/wp/v2/block-patterns/categories 187 120989 0 0 /wp-admin/post.php 180 25648477 0 0 /wp-json/wp/v2/taxonomies 179 443920 0 0 /wp-json/wp/v2/themes 179 221781 0 0 /wp-json/wp/v2/users 179 8055 0 0 /wp-json/wp/v2/pages 132 218734 0 0 /wp-admin/post-new.php 126 17746891 0 0 /wp-json/wp/v2/taxonomies/category 123 112422 0 0 /wp-json/wp/v2/taxonomies/post_tag 123 105042 0 0 /wp-json/wp/v2/categories/1 123 35424 0 0 /chairmans-message/ 92 3244488 0 4 /wp-admin/nav-menus.php 87 9927701 0 0 /principle-message/ 78 2667379 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsjZ0B4gaVQUwaEQXjM.woff 65 380512 5 3 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.woff2 65 2267684 5 1 /about-collage/ 64 2105666 1 1 /vision-mission/ 60 1919545 1 3 /wp-json/wp/v2/pages/472 2 3044 0 0 /wp-admin/upgrade.php 2 42 0 2 /wp-json/wp/v2/pages/1025/autosaves 1 257 0 0 /news/ 12 415138 0 0 /wp-json/wp/v2/pages/695 2 3045 0 0 /wp-json/wp/v2/pages/1039 2 3034 0 0 /wp-json/wp/v2/pages/554 4 6090 0 0 /wp-json/wp/v2/pages/417 2 3058 0 0 /exam-schedule/ 2 55044 0 0 /wp-json/wp/v2/pages/701 2 3047 0 0 /principal/ 2 55004 0 0 /wp-json/wp/v2/pages/907 3 5412 0 0 /wp-json/wp/v2/pages/1037 2 3045 0 0 /wp-json/wp/v2/pages/518 3 5421 0 0 /wp-json/wp/v2/media 3 956 0 0 /english/ 6 165074 1 1 /wp-json/wp/v2/pages/624 2 3041 0 0 /wp-json/wp/v2/pages/493 2 3032 0 0 /wp-admin/load-scripts.php 48 2072844 3 0 /wp-json/wp/v2/pages/990 2 3040 0 0 /wp-json/wp/v2/pages/587 2 3030 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.ttf 2 268080 0 0 /wp-json/wp/v2/pages/390 2 3035 0 0 /wp-json/wp/v2/pages/606 2 3044 0 0 /wp-json/wp/v2/pages/615 2 3055 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsg-1x4gaVQUwaEQXjM.woff 5 83600 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.ttf 4 810976 0 0 /about/ 4 140872 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-brands-400.ttf 2 267976 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-regular-400.woff2 4 53104 1 2 /wp-json/wp/v2/pages/568 2 3034 0 0 /wp-json/wp/v2/pages/596 2 3030 0 0 /wp-json/wp/v2/pages/539 2 3057 0 0 /wp-json/wp/v2/widget-types 1 0 0 0 /wp-json/wp/v2/pages/1045 2 3067 0 0 /wp-json/wp/v2/pages/873 2 3049 0 0 /wp-json/wp/v2/pages/577 2 3029 0 0 /wp-json/wp/v2/pages/417/autosaves 2 515 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsiH0B4kaVQUwaEQXjN_mQ.woff 19 54312 0 0 /wp-json/wp/v2/pages/375 2 3051 0 0 /iqac/ 2 48428 0 1 /wp-json/wp/v2/pages/1035 2 3048 0 0 /wp-json/wp/v2/pages/512 2 3034 0 0 /academics/ 4 133364 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.woff2 47 1535280 0 14 /wp-json/wp/v2/pages/448 2 3033 0 0 /wp-json/wp/v2/pages/877 2 3048 0 0 /wp-json/wp/v2/pages/509 2 3034 0 0 /wp-json/elementor/v1/kit-elements-defaults 53 1166 0 0 /marathi/ 4 112470 1 2 /wp-json/wp/v2/pages/925 2 3039 0 0 /wp-json/wp/v2/pages/1024 1 2384 0 0 /departmental-blogs/ 2 52610 0 0 /wp-json/wp/v2/pages/699 2 3124 0 0 /wp-json/wp/v2/pages/657 2 3046 0 0 /wp-json/wp/v2/pages/426 2 3030 0 0 /elementor-hf/footer/ 12 277724 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.woff 1 90060 0 0 /wp-json/wp/v2/pages/521 2 3037 0 0 /wp-json/wp/v2/pages/487 2 3032 0 0 /wp-json/wp/v2/pages/542 2 3034 0 0 /wp-admin/index.php 2 103292 0 0 /wp-json/wp/v2/pages/1043/autosaves 1 275 0 0 /wp-json/elementor/v1/globals 53 13409 0 0 /wp-json/wp/v2/pages/995 2 3038 0 0 /wp-json/wp/v2/pages/633 2 3035 0 0 /wp-json/wp/v2/pages/871 4 7814 0 0 /wp-json/wp/v2/pages/506/autosaves 1 246 0 0 /wp-json/wp/v2/pages/1031 2 3037 0 0 /wp-json/wp/v2/pages/651 2 3043 0 0 /wp-json/wp/v2/pages/435 2 3043 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-solid-900.ttf 4 810976 0 1 /wp-json/wp/v2/pages/496 2 3033 0 0 /wp-json/wp/v2/templates 2 44 0 0 /wp-json/wp/v2/pages/685 2 3046 0 0 /wp-json/wp/v2/pages/915 2 3032 0 0 /wp-login.php 3 4372 0 1 /wp-json/wp/v2/pages/660 2 3051 0 0 /wp-json/wp/v2/pages/454 2 3033 0 0 /wp-json/wp/v2/pages/1033 2 3046 0 0 /wp-json/wp/v2/pages/571 3 5426 0 0 /wp-admin/ 45 2298125 16 0 /wp-json/wp/v2/pages/593 2 3039 0 0 /wp-content/plugins/wpforms-lite/assets/images/integrations/elementor/font/icon-wpforms.woff2 10 10528 0 0 /wp-admin/async-upload.php 3 1994 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.woff 2 203304 0 0 /wp-json/wp/v2/pages/707/autosaves 1 272 0 0 /time-table/ 2 55014 1 0 /wp-json/wp/v2/pages/1009 1 2384 0 0 /wp-json/wp/v2/pages/548 2 3049 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-solid-900.woff 2 203296 0 0 /wp-json/wp/v2/pages/462 2 3045 0 0 /wp-json/wp/v2/pages/919 2 3055 0 0 /wp-json/wp/v2/pages/689 2 3052 0 0 /wp-content/plugins/smart-slider-3/Public/SmartSlider3/Application/Admin/Assets/fonts/SmartSliderIcons.woff2 3 73776 0 0 /wp-json/wp/v2/pages/703 2 3067 0 0 /wp-admin/about.php 10 394079 0 0 /wp-json/wp/v2/pages/384 2 3034 0 0 /wp-admin/theme-install.php 2 75530 0 0 /infrastructure-2/ 4 141126 0 0 /wp-admin/themes.php 13 655571 0 0 /wp-admin/load-styles.php 35 5352631 0 0 /department-of-english/ 28 964284 0 0 /wp-json/wp/v2/pages/707 2 3070 0 0 /wp-json/wp/v2/pages/1029 2 3037 0 0 /wp-json/wp/v2/pages/411 2 3049 0 0 /wp-json/wp/v2/pages/901 2 3048 0 0 /wp-includes/js/tinymce/skins/lightgray/fonts/tinymce.woff 6 75296 0 0 /wp-json/wp/v2/pages/1025 2 3058 0 0 /student-feedback/ 2 55156 0 0 /wp-json/wp/v2/pages/881 2 3049 0 0 /wp-json/wp/v2/pages/423 2 3045 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-brands-400.woff2 2 153472 0 0 /wp-json/wp/v2/pages/999 2 3035 0 0 /wp-json/wp/v2/pages/484 2 3035 0 0 /wp-content/fonts/poppins/pxiByp8kv8JHgFVrLGT9Z1xlE92JQEk.woff 52 186696 1 5 /statutory-committee/ 2 54490 0 0 /wp-content/plugins/elementor/assets/lib/eicons/fonts/eicons.woff2 26 754560 1 0 /wp-json/omapp/v1/notifications/ 1 691 0 0 /wp-json/wp/v2/pages/545 2 3032 0 0 /wp-json/wp/v2/pages/420 2 3050 0 0 /wp-json/wp/v2/pages/875 2 3051 0 0 /wp-content/plugins/bellows-accordion-menu/assets/css/fontawesome/fonts/fontawesome-webfont.woff2 10 257856 0 0 /wp-json/wp/v2/pages/909 2 3054 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsjZ0B4kaVQUwaEQXjN_mQ.woff 19 54576 0 0 /wp-content/plugins/optinmonster/assets/fonts/fontawesome-webfont.woff2 1 77160 0 0 /forms/ 8 246164 0 2 /wp-json/wp/v2/pages/499 2 3033 0 0 /wp-json/wp/v2/pages/469 2 3060 0 0 /wp-json/wp/v2/pages/1001 2 3037 0 0 /wp-admin/admin.php 13 943736 0 0 /wp-json/wp/v2/pages/923 2 3032 0 0 /wp-json/wp/v2/pages/648 2 3028 0 0 /wp-json/wp/v2/pages/343 6 15875 0 0 /wp-json/wp/v2/pages/911 2 3043 0 0 /wp-json/wp/v2/pages/681 2 3039 0 0 /academic-calendar/ 8 219676 0 4 /faculties-2/ 4 140826 0 0 /wp-json/wp/v2/pages/693 2 3032 0 0 /wp-admin/plugins.php 16 721403 0 0 /wp-json/wp/v2/pages/590 2 3033 0 0 /wp-json/wp/v2/pages/438 2 3045 0 0 /wp-json/wp/v2/pages/387 3 5418 0 0 /wp-json/wp/v2/pages/6 29 85320 0 0 /wp-json/wp/v2/users/me 8 7161 0 0 /wp-json/wp/v2/pages/465 2 3050 0 0 /wp-json/wp/v2/pages/630 2 3044 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-brands-400.woff 1 89988 0 0 /wp-json/wp/v2/pages/879 2 3051 0 0 /wp-json/omapp/v1/notifications 17 10737 0 0 /wp-json/wp/v2/pages/1047 2 3045 0 0 /wp-json/wp/v2/pages/551 2 3031 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-solid-900.woff2 7 469608 0 0 /bachelor-of-management-studies/ 2 51692 0 1 /staff-list/ 8 248344 0 0 /wp-json/wp/v2/pages/71 3 7152 0 0 /iqac-committee/ 4 109750 1 0 /wp-content/plugins/smart-slider-3/Public/SmartSlider3/Application/Admin/Assets/fonts/Inter-SemiBold.woff2 6 383152 0 0 /wp-json/wp/v2/pages/621 2 3039 0 0 /wp-json/wp/v2/pages/697 2 3054 0 0 /wp-json/wp/v2/pages/1041 2 3030 0 0 /contact-us/ 34 1157218 1 0 /wp-json/wp/v2/pages/475 4 6142 0 0 /wp-json/wp/v2/pages/414 6 12594 0 0 /wp-json/wp/v2/pages/609 2 3046 0 0 /wp-json/wp/v2/pages/705 2 3065 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-regular-400.woff2 1 13224 0 0 /wp-content/plugins/smart-slider-3/Public/SmartSlider3/Application/Admin/Assets/fonts/Inter-Medium.woff2 6 381024 0 0 /wp-json/wp/v2/pages/502 2 3061 0 0 /wp-admin/customize.php 1 633175 0 0 /wp-json/wp/v2/pages/691 2 3030 0 0 /wp-json/wp/v2/pages/378 7 14970 0 0 /wp-content/fonts/poppins/pxiByp8kv8JHgFVrLCz7Z1xlE92JQEk.woff 1 10432 0 0 /wp-json/wp/v2/pages/1003 2 3046 0 0 /wp-json/wp/v2/pages/627 3 5426 0 0 /wp-json/contact-form-7/v1/contact-forms/322/feedback/schema 8 1328 0 0 /wp-json/wp/v2/pages/1027 2 3066 0 0 /wp-json/wp/v2/pages/1001/autosaves 1 248 0 0 /wp-json/wp/v2/pages/584 2 3043 0 0 /wp-json/wp/v2/pages/612 2 3059 0 0 /wp-json/wp/v2/pages/445 2 3039 0 0 /wp-json/wp/v2/pages/899 2 3045 0 0 /wp-content/fonts/lato/S6u9w4BMUTPHh6UVSwiPGQ.woff2 10 92160 0 0 /wp-content/plugins/header-footer-elementor/assets/fonts/hfe.ttf 20 31392 0 0 /wp-json/wp/v2/pages/381 2 3031 0 0 /wp-json/wp/v2/pages/475/autosaves 2 579 0 0 /wp-json/wp/v2/pages/407 2 3031 0 0 /wp-json/wp/v2/pages/451 2 3042 0 0 /wp-json/wp/v2/pages/393 2 3050 0 0 /wp-json/wp/v2/pages/372 2 3033 0 0 /wp-json/wp/v2/pages/574 2 3038 0 0 /wp-json/wp/v2/pages/515 2 3036 0 0 /hindi/ 2 51452 1 0 /wp-json/wp/v2/pages/64 1 2384 0 0 /wp-json/wp/v2/pages/917 2 3045 0 0 /wp-json/wp/v2/pages/687 2 3043 0 0 /wp-json/wp/v2/pages/554/autosaves 1 240 0 0 /wp-json/wp/v2/pages/506 2 3038 0 0 /wp-json/wp/v2/pages/524 2 3062 0 0 /wp-json/wp/v2/pages/683 2 3047 0 0 /wp-json/wp/v2/pages/913 2 3033 0 0 /wp-json/wp/v2/pages/988 2 3034 0 0 /wp-json/wp/v2/pages/618 2 3046 0 0 /elementor-hf/header/ 20 462912 0 0 /wp-json/wp/v2/pages/986 2 3034 0 0 /wp-json/wp/v2/pages/921 3 5417 0 0 /wp-json/wp/v2/pages/654 2 3046 0 0 /wp-json/wp/v2/pages/536 2 3044 0 0 /wp-json/wp/v2/pages/490 2 3031 0 0 /wp-json/wp/v2/pages/997 2 3037 0 0 /wp-json/wp/v2/pages/907/autosaves 1 244 0 0 /wp-json/wp/v2/pages/1043 2 3082 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsg-1x4kaVQUwaEQXjN_mQ.woff 19 52704 0 0 /wp-admin/plugin-install.php 1 44904 0 0 END_SIDER