AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202408 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2686 POS_VISITOR 6584 POS_DAY 6736 POS_DOMAIN 3277 POS_LOGIN 3518 POS_ROBOT 3673 POS_WORMS 3923 POS_EMAILSENDER 4054 POS_EMAILRECEIVER 4197 POS_SESSION 6838 POS_SIDER 6975 POS_FILETYPES 4332 POS_DOWNLOADS 4414 POS_OS 4586 POS_BROWSER 4684 POS_SCREENSIZE 4779 POS_UNKNOWNREFERER 4853 POS_UNKNOWNREFERERBROWSER 4940 POS_ORIGIN 5022 POS_SEREFERRALS 5152 POS_PAGEREFS 5296 POS_SEARCHWORDS 5444 POS_KEYWORDS 5596 POS_MISC 2350 POS_ERRORS 5655 POS_CLUSTER 3374 POS_SIDER_404 5777 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240902042953 1 0 8132161955794 FirstTime 0 LastTime 0 LastUpdate 20240902182734 1 0 0 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 3 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 PDFSupport 0 0 0 JavaEnabled 0 0 0 DirectorSupport 0 0 0 FlashSupport 0 0 0 JavascriptDisabled 0 0 0 TotalMisc 0 0 0 AddToFavourites 0 2 0 RealPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 99 99 1212245 1 0 0 0 138 140 1651384 2 0 0 0 4 4 0 3 0 0 0 77 82 2152545 4 0 0 0 37 42 2229890 5 0 0 0 5 5 37178 6 0 0 0 4 6 220 7 0 0 0 5 5 226 8 0 0 0 4 6 220 9 0 0 0 2 2 0 10 0 0 0 8 8 0 11 0 0 0 4 4 0 12 0 0 0 5 7 220 13 0 0 0 5 5 226 14 0 0 0 2 2 0 15 0 1 1832037 71 74 2627309 16 0 1 1364622 33 34 1772810 17 0 0 0 2 2 36952 18 0 0 0 2 4 37172 19 0 0 0 90 90 1201990 20 0 2 2729244 0 0 0 21 0 0 0 5 5 226 22 0 0 0 34 34 405823 23 0 0 0 33 33 397413 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 2 in 0 1 1364622 us 0 3 4561281 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 Go\-http\-client/ 68 21250 20240830163514 0 bingbot/ 12 1320 20240823043848 12 Googlebot/ 10 6393978 20240808032321 6 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 pdf 4 5925903 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 2 /wp-content/uploads/2024/02/B.Ed-Syllabus-2017-18.pdf 5 0 6823110 /wp-content/uploads/2024/02/migrationform.pdf 3 0 5496111 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 2 androidmarshmallow 3 0 win10 1 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 2 chrome126.0.6478.182 3 0 chrome127.0.0.0 1 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 0 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 3 From1 0 0 From2 0 0 From3 0 0 From4 0 1 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 406 25 5650 404 404 7341851 302 8 0 301 164 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 22 /telescope/requests 34 - /phpinfo 2 - /.aws/credentials 2 - /config.json 17 - /debug/default/view 34 - /info 2 - /phpinfo.php 2 - /.git/config 42 - /php_info 2 - /.aws/credentials.gpg 4 - /_profiler/phpinfo.php 2 - /_profiler/phpinfo 2 - /login.action 34 - /php_info.php 2 - /.vscode/sftp.json 17 - /info.php 2 - /s/730323e2834323e20313e2631323/_/ 34 - /.DS_Store 34 - /server 34 - /v2/_catalog 34 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 34 - /_all_dbs 34 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 3 103.196.76.5 0 1 1364622 66.249.79.103 0 1 1364622 66.249.79.102 0 2 3196659 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 2 20240803 0 3 4561281 0 20240824 0 1 1364622 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER