AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202408 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2048 POS_TIME 2725 POS_VISITOR 9156 POS_DAY 10589 POS_DOMAIN 3361 POS_LOGIN 3673 POS_ROBOT 3828 POS_WORMS 4119 POS_EMAILSENDER 4250 POS_EMAILRECEIVER 4393 POS_SESSION 11075 POS_SIDER 11222 POS_FILETYPES 4528 POS_DOWNLOADS 4646 POS_OS 4694 POS_BROWSER 4955 POS_SCREENSIZE 5508 POS_UNKNOWNREFERER 5582 POS_UNKNOWNREFERERBROWSER 6176 POS_ORIGIN 6578 POS_SEREFERRALS 6712 POS_PAGEREFS 6856 POS_SEARCHWORDS 7004 POS_KEYWORDS 7156 POS_MISC 2389 POS_ERRORS 7215 POS_CLUSTER 3529 POS_SIDER_404 7317 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240901013535 29 4770 9680961780945 FirstTime 20240801042343 LastTime 20240831125213 LastUpdate 20240901183437 29 0 28 0 0 TotalVisits 40 TotalUnique 32 MonthHostsKnown 0 MonthHostsUnknown 36 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 PDFSupport 0 0 0 JavaEnabled 0 0 0 RealPlayerSupport 0 0 0 TotalMisc 0 0 0 JavascriptDisabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 FlashSupport 0 0 0 DirectorSupport 0 0 0 AddToFavourites 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 4 4 196588 0 0 0 1 2 4 30185 62 66 48964 2 2 2 27956 0 7 2506 3 9 10 182653 33 36 164231 4 6 7 154697 0 23 8234 5 0 0 0 4 5 29163 6 2 4 30185 0 2 0 7 0 0 0 0 0 0 8 4 5 126741 2 2 98294 9 0 0 0 0 0 0 10 0 0 0 2 2 98294 11 6 13 267752 0 0 0 12 4 11 169458 0 0 0 13 10 12 353023 0 10 2864 14 10 20 256046 3 12 101026 15 4 6 58141 2 6 28672 16 10 11 112315 2 34 39413 17 0 0 0 0 0 0 18 0 0 0 1 1 226 19 2 2 98294 8 9 100536 20 4 6 128479 1 1 226 21 2 2 27956 28 37 110692 22 6 15 199643 6 7 2242 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 7 us 46 67 1402685 cn 10 20 254799 ru 9 9 83868 ca 8 20 478610 in 8 8 111824 be 4 8 60370 gb 2 2 27956 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 4 no_user_agent 12 589764 20240831194824 0 scanner 9 85341 20240830165604 0 Go\-http\-client/ 8 57344 20240831014542 0 archive\.org_bot 2 27956 20240830154156 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 3 js 24 452220 0 0 png 23 20022 0 0 html 87 1947870 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 15 linux 7 2 android 2 2 win10 44 39 macosx14 1 0 macosx6 2 2 macosx15 12 8 androidpie 2 2 macosx 8 2 androidmarshmallow 2 2 macosx10 2 2 winxp 3 0 Unknown 42 22 win8.1 2 0 win7 3 2 linuxubuntu 2 2 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 26 chrome103.0.5060.114 2 2 Unknown 14 8 opera12.16 1 0 chrome41.0.2227.1 2 2 chrome37.0.2049.0 1 0 mozilla 33 16 chrome126.0.0.0 15 10 firefox40.1 1 0 chrome68.0.3440.75 2 2 opera11.50 1 0 safari4.0.4 2 2 chrome96.0.4664.110 12 8 chrome110.0.0.0 2 2 chrome56.0.2924.87 2 2 opera11.10 1 0 edge12 2 2 firefox52.59.12 1 0 opera12.0 1 0 chrome108.0.0.0 9 9 chrome101.0.4951.61 2 2 opera11.01 1 0 chrome52.0.3624.98 2 2 chrome87.0.4280.88 8 2 firefox29.0 2 2 chrome34.0.1866.237 1 0 chrome100.0.4896.60 14 14 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 4 python-httpx/0.27.2 20240831125240 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240830133949 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20240826010711 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20240828224322 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 2 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240830133949 python-httpx/0.27.2 20240831125240 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 87 123 From1 0 0 From2 0 0 From3 0 0 From4 0 11 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 2 404 198 70884 406 19 4294 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 63 /.ssh/id_ecdsa 2 - /static/admin/javascript/hetong.js 1 - /.ssh/id_ed25519 2 - /.gitlab-ci.yml 4 - /sendgrid.env 2 - /server 2 - /.env.production 2 - /vendor/bootstrap/js/bootstrap.bundle.min.js 11 - /.env_exemple 2 - /vendor/php-email-form/validate.js 11 - //maxcdn.bootstrapcdn.com/bootstrap/3.4.1/js/bootstrap.min.js 10 - /_vti_pvt/administrators.pwd 2 - /wp-admin/setup-config.php 1 - /.svn/wc.db 2 - /env.js 2 - /config.yml 2 - /config.yaml 2 - /debug/default/view 2 - /php_info 2 - /config/database.php 2 - /cloud-config.yml 2 - /.DS_Store 2 - /config.php 2 - /.aws/credentials 8 - /config.json 2 - /user_secrets.yml 2 - /feed 2 - /config/production.json 1 - /s/730323e2834323e20313e2631323/_/ 2 - /login.action 2 - /vendor/swiper/swiper-bundle.min.js 10 - /wp-config.php 2 - /telescope/requests 2 - /_vti_pvt/authors.pwd 2 - /Public/home/js/check.js 1 - /_all_dbs 2 - /.kube/config 2 - /php_info.php 2 - /.git/HEAD 2 - //ajax.googleapis.com/ajax/libs/jquery/3.6.3/jquery.min.js 11 - /.git/config 4 - /docker-compose.yml 2 - /server.key 2 - /_vti_pvt/service.pwd 2 - /.env.exemple 1 - /_profiler/phpinfo.php 2 - /js/main.js 11 - /_profiler/phpinfo 2 - /.idea/workspace.xml 2 - /vendor/purecounter/purecounter_vanilla.js 10 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 2 - /phpinfo.php 4 - /v2/_catalog 2 - /info.php 2 - /backup.tar.gz 1 - /phpinfo 2 - /config.xml 2 - /info 2 - /vendor/glightbox/js/glightbox.min.js 10 - /.vscode/sftp.json 2 - /about 2 - /backup.zip 1 - /secrets.json 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 36 35.171.144.152 10 10 491470 20240822002613 45.148.10.59 8 8 111824 20240828025632 195.211.77.142 5 5 55912 20240830033531 111.7.96.171 4 11 169458 20240814223821 47.242.224.70 4 16 282022 20240830140424 54.88.179.33 4 4 196588 20240820082300 89.175.184.250 3 3 27956 20240830160812 209.38.208.202 2 2 98294 20240830033449 3.37.16.156 2 2 27956 20240805162052 159.65.157.106 2 3 28447 20240828081159 167.94.146.51 2 4 30185 20240826010709 184.72.145.180 2 2 27956 20240811043322 167.99.193.215 2 3 28447 20240830141302 111.7.96.178 2 3 28447 20240821034542 47.88.94.161 2 2 27956 20240830154317 87.236.176.172 2 2 27956 20240828224320 111.7.96.168 2 3 28447 20240804111942 206.168.34.120 2 4 30185 20240802143036 64.23.152.40 2 3 28447 20240819141322 205.210.31.135 2 2 98294 20240813200508 147.185.132.225 2 2 98294 20240830133949 162.142.125.219 2 4 30185 20240803063425 198.235.24.58 2 2 98294 20240817113747 98.80.142.7 2 8 141011 20240831125214 162.142.125.195 2 4 30185 20240802153522 87.236.176.48 0 1 1738 195.211.77.140 1 1 0 20240830033515 87.236.176.91 0 1 491 123.160.223.75 0 1 491 87.236.176.10 0 1 1738 134.122.95.155 2 3 28447 20240805162015 134.209.147.239 2 3 28447 20240814120022 123.160.223.73 2 2 27956 20240826040919 87.236.176.14 2 3 28447 20240807200454 146.70.189.40 2 2 27956 20240830033542 199.45.154.157 2 4 30185 20240803130336 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 20 20240801 2 2 98294 1 20240802 4 8 60370 2 20240803 4 8 60370 2 20240804 2 3 28447 1 20240805 7 8 84359 3 20240807 2 4 30185 1 20240811 2 2 27956 1 20240813 2 2 98294 1 20240814 6 14 197905 2 20240816 2 2 27956 1 20240817 2 2 98294 1 20240818 2 2 98294 1 20240819 6 7 225035 2 20240820 2 2 98294 1 20240821 4 5 56403 2 20240822 4 4 196588 1 20240826 6 9 86588 3 20240828 6 9 86588 3 20240830 20 33 618881 10 20240831 2 8 141011 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 40 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 87 1947870 40 40 END_SIDER