AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202408 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2694 POS_VISITOR 8277 POS_DAY 8630 POS_DOMAIN 3399 POS_LOGIN 3655 POS_ROBOT 3810 POS_WORMS 4145 POS_EMAILSENDER 4276 POS_EMAILRECEIVER 4419 POS_SESSION 8925 POS_SIDER 9062 POS_FILETYPES 4554 POS_DOWNLOADS 4670 POS_OS 5397 POS_BROWSER 5498 POS_SCREENSIZE 5662 POS_UNKNOWNREFERER 5736 POS_UNKNOWNREFERERBROWSER 6203 POS_ORIGIN 6285 POS_SEREFERRALS 6416 POS_PAGEREFS 6560 POS_SEARCHWORDS 6708 POS_KEYWORDS 6860 POS_MISC 2357 POS_ERRORS 6919 POS_CLUSTER 3511 POS_SIDER_404 7055 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240901022916 3 440 14093957492500 FirstTime 0 LastTime 0 LastUpdate 20240901183441 3 0 2 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 11 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 WindowsMediaPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 FlashSupport 0 0 0 AddToFavourites 0 10 0 DirectorSupport 0 0 0 QuickTimeSupport 0 0 0 JavaEnabled 0 0 0 RealPlayerSupport 0 0 0 TotalMisc 0 0 0 PDFSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 4 7 897935 1 0 1 897689 16 33 310979 2 0 0 0 12 20 149667 3 0 0 0 42 43 957327 4 0 0 0 8 12 208546 5 0 1 77381 72 82 2021908 6 0 2 154762 4 18 67046 7 0 0 0 0 4 246 8 0 0 0 35 43 894610 9 0 0 0 14 21 335104 10 0 0 0 8 11 493790 11 0 1 32429 101 101 2634250 12 0 0 0 37 42 886426 13 0 1 897689 41 48 886426 14 0 3 520084 78 93 2272358 15 0 1 166285 45 55 1460964 16 0 4 1180064 72 78 1758524 17 0 1 166285 167 175 4693436 18 0 0 0 210 213 5826748 19 0 0 0 175 185 4743078 20 0 0 0 15 25 269818 21 0 0 0 104 108 2496213 22 0 1 77381 6 15 63202 23 0 1 282406 37 47 1164396 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 jp 0 1 166285 in 0 6 1589113 us 0 10 2697057 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 5 Go\-http\-client/ 132 42572 20240830170428 0 Googlebot/ 122 1274220 20240831094242 80 bingbot/ 22 893474 20240829183106 18 facebookexternalhit/ 8 1097291 20240831234126 4 crawl 2 149452 20240821013133 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 3 jpg 1 32429 0 0 pdf 14 4209722 0 0 png 2 210304 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 10 /wp-content/uploads/2024/01/Tejasvi-Bhandari-madam-FACULTY-PROFILE.pdf 7 0 1163995 /wp-content/uploads/2024/01/Academic-Calender-2022-23.pdf 6 0 464286 /wp-content/uploads/2024/01/Faculty-Profile.pdf 4 0 168060 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 4 0 3590756 /wp-content/uploads/2024/01/Kadam-P.A.pdf 3 0 847218 /wp-content/uploads/2024/01/Academic-Calender-2019-20.pdf 3 0 214179 /wp-content/uploads/2024/01/Academic-Calender-2021-22.pdf 2 0 144142 /wp-content/uploads/2024/01/Department-of-English-CO.pdf 2 0 804334 /wp-content/uploads/2024/01/Academic-Calender-2020-21.pdf 1 0 62444 /wp-content/uploads/2024/01/Academic-Calender-2018-19.pdf 1 0 65253 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 3 Unknown 6 0 android10 4 0 win10 7 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 5 chrome127.0.6533.119 3 0 chrome127.0.0.0 8 0 chrome127.0.6533.99 2 0 chrome126.0.6478.182 1 0 chrome121.0.0.0 3 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 3 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/127.0.6533.99_Safari/537.36 20240815145651 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/126.0.6478.182_Safari/537.36 20240807065340 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/127.0.6533.119_Safari/537.36 20240830052944 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 6 From1 0 0 From2 0 0 From3 0 0 From4 0 11 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 301 330 0 409 1 1200 404 792 32023488 406 50 11300 302 10 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 42 /.DS_Store 64 - /secrets.json 1 - /s/730323e2834323e20313e2631323/_/ 64 - /_all_dbs 64 - /.ssh/id_ecdsa 2 - /user_secrets.yml 2 - /.gitlab-ci.yml 4 - /config.json 33 - /.vscode/sftp.json 33 - /config.php 2 - /sitemap_index.xml 8 - /telescope/requests 64 - /.git/HEAD 2 - /config.xml 2 - /server.key 2 - /.aws/credentials 6 - /docker-compose.yml 2 - /v2/_catalog 64 - /static/admin/javascript/hetong.js 1 - /.kube/config 2 - /.git/config 74 - /sitemap.txt 4 - /.env.production 2 - /config/database.php 2 - /debug/default/view 64 - /sitemap.xml.gz 4 - /.svn/wc.db 2 - /my-account/ 2 - /backup.tar.gz 1 - /.ssh/id_ed25519 2 - /config.yaml 2 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 64 - /sitemaps.xml 8 - /config.yml 2 - /env.js 2 - /server 64 - /phpinfo.php 2 - /config/production.json 1 - /backup.zip 1 - /Public/home/js/check.js 1 - /cloud-config.yml 2 - /login.action 64 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 11 66.249.68.35 0 1 77381 103.31.40.21 0 1 166285 152.58.30.145 0 1 166285 115.98.232.143 0 2 210304 115.98.234.190 0 2 930118 66.249.68.37 0 4 298226 103.176.135.79 0 2 448691 152.59.8.84 0 1 897689 152.58.30.103 0 1 282406 66.249.68.38 0 1 77381 152.58.31.30 0 1 897689 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 11 20240805 0 1 897689 0 20240807 0 3 287685 0 20240810 0 1 77381 0 20240811 0 2 930118 0 20240812 0 2 448691 0 20240814 0 1 166285 0 20240815 0 3 520084 0 20240819 0 1 897689 0 20240824 0 1 72071 0 20240828 0 1 77381 0 20240830 0 1 77381 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER