AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202508 will be lost/reset. # Last config file used to build this data file was /home/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2081 POS_TIME 2740 POS_VISITOR 8565 POS_DAY 9647 POS_DOMAIN 3320 POS_LOGIN 3624 POS_ROBOT 3779 POS_WORMS 4098 POS_EMAILSENDER 4229 POS_EMAILRECEIVER 4372 POS_SESSION 10011 POS_FILESIZE 10246 POS_SIDER 10168 POS_FILETYPES 4507 POS_DOWNLOADS 4589 POS_OS 4637 POS_BROWSER 4796 POS_SCREENSIZE 5168 POS_UNKNOWNREFERER 5242 POS_UNKNOWNREFERERBROWSER 5899 POS_ORIGIN 6137 POS_SEREFERRALS 6269 POS_PAGEREFS 6413 POS_SEARCHWORDS 6561 POS_KEYWORDS 6713 POS_MISC 2404 POS_ERRORS 6772 POS_CLUSTER 3480 POS_SIDER_404 6868 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250901071708 2 81 9396420109461 FirstTime 0 LastTime 20250831080418 LastUpdate 20250901081120 2 0 1 0 0 TotalVisits 29 TotalUnique 27 MonthHostsKnown 0 MonthHostsUnknown 27 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 FlashSupport 0 0 0 TotalMisc 0 0 0 JavascriptDisabled 0 0 0 DirectorSupport 0 0 0 PDFSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 AddToFavourites 0 0 0 JavaEnabled 0 0 0 RealPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 13 23 5811 1 1 1 447 3 8 0 2 1 1 447 2 5 447 3 3 3 1341 6 8 2235 4 0 0 0 14 17 4470 5 0 0 0 0 2 0 6 0 0 0 3 3 0 7 1 1 447 37 42 894 8 2 2 894 1 3 447 9 0 0 0 1 3 447 10 0 0 0 6 11 2682 11 1 1 447 2 7 447 12 1 1 447 5 9 2235 13 4 4 1788 5 9 1788 14 1 1 447 5 8 2235 15 3 3 1341 2 8 447 16 1 1 447 22 25 3129 17 0 0 0 2 5 0 18 5 5 1788 29 31 3129 19 5 5 2235 10 18 4023 20 0 0 0 1 7 447 21 0 0 0 2 7 322 22 2 2 894 12 18 4917 23 1 1 447 6 12 2682 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 8 us 16 16 7152 ca 6 6 2682 cn 3 3 1341 fi 2 2 894 ru 2 2 447 in 1 1 447 bg 1 1 447 be 1 1 447 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 5 bot[\s_+:,\.\;\/\\-] 81 36207 20250830195653 0 no_user_agent 8 3576 20250831224622 0 Go\-http\-client/ 3 1341 20250831072201 0 scrapy 2 894 20250802095826 0 survey 2 894 20250811040745 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 html 32 13857 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 7 Unknown 12 12 macosx15 1 1 win7 5 5 win10 7 7 linux 5 5 androidmarshmallow 1 1 androidpie 1 1 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 17 chrome52.0.3624.98 1 1 chrome139.0.0.0 2 2 chrome108.0.0.0 2 2 mozilla 6 6 safari1.0 1 1 chrome71.0.2623.112 2 2 firefox90.0 1 1 Unknown 5 5 chrome76.0.3809.111 1 1 chrome63.0.3239.132 1 1 edge18 3 3 chrome113.0.0.0 1 1 chrome67.0.3396.99 1 1 firefox137.0 1 1 firefox139.0 2 2 chrome91.0.4472.114 1 1 chrome137.0.0.0 1 1 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 5 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20250819011316 Mozilla/5.0_(compatible;_UGAResearchAgent/1.0;_Please_visit:_NISLabUGA.github.io) 20250830183415 Hello_from_Palo_Alto_Networks,_find_out_more_about_our_scans_in_https://docs-cortex.paloaltonetworks.com/r/1/Cortex-Xpanse/Scanning-activity 20250829123859 Mozilla/5.0_(webOS/1.3;_U;_en-US)_AppleWebKit/525.27.1_(KHTML,_like_Gecko)_Version/1.0_Safari/525.27.1_Desktop/1.0 20250816190902 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20250825195750 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Hello_from_Palo_Alto_Networks,_find_out_more_about_our_scans_in_https://docs-cortex.paloaltonetworks.com/r/1/Cortex-Xpanse/Scanning-activity 20250829123859 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 32 32 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 2 421 1 322 404 177 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 70 /_all_dbs 1 - /wp-admin/setup-config.php 1 - /server.key 1 - /user_secrets.yml 1 - /config/production.json 1 - /.vscode/sftp.json 2 - /.ssh/id_rsa 1 - /v2/_catalog 1 - /admin/.env 1 - /.env.prod 1 - /wiki 1 - /phpinfo 1 - /.env.example 1 - /security.txt 1 - /server-status 2 - /.env 6 - /application/.env 1 - / 1 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 1 - /config.yml 1 - /docker-compose.yml 1 - /robots.txt 80 - /.ssh/id_ecdsa 1 - /.DS_Store 1 - /@vite/env 1 - /backup.sql 1 - /database_backup.sql 1 - /backup.zip 1 - /.ssh/id_ed25519 1 - /dump.sql 1 - /feed 1 - /login.action 1 - /telescope/requests 1 - /_fragment 1 - /.aws/credentials 1 - /_vti_pvt/service.pwd 1 - /info.php 1 - /debug/default/view 1 - /config.xml 1 - /etc/ssl/private/server.key 1 - /s/7343e2334323e20313e2631323/_/ 1 - /config.json 2 - /cloud-config.yml 1 - /vendor/phpunit/phpunit/src/Util/PHP/eval-stdin.php 3 - /database.sql 1 - /backend/.env 1 - /phpinfo.php 2 - /about 1 - /.well-known/security.txt 2 - /server 1 - /db/schema.rb 1 - /info 1 - /.svn/wc.db 1 - /config.yaml 1 - /secrets.json 1 - /php_info.php 1 - /dev/.env 1 - /_ignition/execute-solution 4 - /.env.production 1 - /web.config 1 - /wp-config.php 1 - /_profiler/phpinfo 1 - /config.php 1 - /.env.save 1 - /settings.py 1 - /actuator/env 1 - /.git/config 13 - /.git/HEAD 1 - /backup.tar.gz 1 - /api/.env 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 27 115.231.78.12 3 3 1341 20250816221526 162.142.125.35 2 2 894 20250815133119 199.45.154.140 2 2 894 20250825195750 81.29.134.51 2 2 894 20250820193811 45.148.10.80 1 1 447 20250816190902 44.246.31.169 1 1 447 20250831030325 198.235.24.55 1 1 447 20250818234039 205.210.31.74 1 1 447 20250822222513 195.211.77.140 1 1 0 20250830183218 142.93.38.167 1 1 447 20250818081017 164.92.246.37 1 1 447 20250831024746 143.198.239.27 1 1 447 20250827115653 34.221.53.163 1 1 447 20250807071134 54.186.12.147 1 1 447 20250831080418 198.235.24.96 1 1 447 20250812131508 35.94.148.77 1 1 447 20250819191531 34.215.205.130 1 1 447 20250831030237 64.226.78.121 1 1 447 20250830183202 143.244.47.75 1 1 447 20250830183311 138.197.27.184 1 1 447 20250813141724 205.210.31.165 1 1 447 20250829123859 195.211.77.142 1 1 447 20250830183242 205.210.31.196 1 1 447 20250807165603 87.236.176.200 1 1 447 20250819011316 104.131.173.153 1 1 447 20250804032758 128.192.12.106 1 1 447 20250830183415 93.123.109.225 1 1 447 20250827135852 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 16 20250804 1 1 447 1 20250807 2 2 894 2 20250810 1 1 447 1 20250812 1 1 447 1 20250813 1 1 447 1 20250815 2 2 894 1 20250816 4 4 1788 3 20250818 2 2 894 2 20250819 2 2 894 2 20250820 1 1 447 1 20250822 1 1 447 1 20250825 2 2 894 1 20250827 2 2 894 2 20250829 1 1 447 1 20250830 5 5 1788 5 20250831 4 4 1788 4 END_DAY # Session range - Number of visits BEGIN_SESSION 2 30s-2mn 1 0s-30s 28 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 32 13857 29 29 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 2 0-44 193 100-500 128 END_FILESIZE