AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202309 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2719 POS_VISITOR 9108 POS_DAY 11508 POS_DOMAIN 3520 POS_LOGIN 3846 POS_ROBOT 4001 POS_WORMS 4249 POS_EMAILSENDER 4380 POS_EMAILRECEIVER 4523 POS_SESSION 12320 POS_SIDER 12529 POS_FILETYPES 4658 POS_DOWNLOADS 5015 POS_OS 5193 POS_BROWSER 5410 POS_SCREENSIZE 5748 POS_UNKNOWNREFERER 5822 POS_UNKNOWNREFERERBROWSER 6536 POS_ORIGIN 7058 POS_SEREFERRALS 7206 POS_PAGEREFS 7369 POS_SEARCHWORDS 7562 POS_KEYWORDS 7714 POS_MISC 2381 POS_ERRORS 7773 POS_CLUSTER 3702 POS_SIDER_404 7942 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20231003125126 1 0 31325482405583 FirstTime 20230901102926 LastTime 20230930050425 LastUpdate 20231003181406 1 0 0 0 0 TotalVisits 160 TotalUnique 55 MonthHostsKnown 0 MonthHostsUnknown 57 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 QuickTimeSupport 0 0 0 TotalMisc 0 0 0 AddToFavourites 0 262 0 JavaEnabled 0 0 0 RealPlayerSupport 0 0 0 FlashSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 DirectorSupport 0 0 0 PDFSupport 0 0 0 JavascriptDisabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 5 5 460692 29 29 378008 1 0 0 0 0 0 0 2 0 0 0 0 0 0 3 2 2 83740 2 2 377734 4 4 4 113906 38 38 62444 5 11 12 633051 29 31 3664 6 38 149 1051691 0 7 336576 7 12 47 250714 0 1 27219 8 37 244 7156946 6 12 27751 9 114 248 4403420 3 16 353453 10 814 2465 14307768 20 54 493586 11 1390 3217 38506441 56 81 153350 12 2329 3453 49219302 9 115 608660 13 2138 2784 35372621 41 107 941038 14 1143 1449 7713060 6 28 378979 15 1917 2733 27264082 20 87 685444 16 4630 6502 76369403 46 263 628968 17 3729 5048 68630926 13 87 621936 18 285 432 5896179 3 16 747 19 6 14 3436914 0 4 27403 20 29 117 4882933 0 36 27925 21 6 41 75846 0 1 27154 22 11 12 802911 62 64 717382 23 2 2 377734 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 7 in 14102 23643 308814899 us 4537 5323 35533099 ca 4 4 755468 be 4 5 163817 cn 2 2 341770 nl 2 2 84426 ru 1 1 37948 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 Go\-http\-client/ 24 7692 20230917005725 0 no_user_agent 12 2220648 20230924032119 0 unknown 2 260 20230904150005 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 14 svg 128 293579 0 0 php 12686 95042159 0 0 woff 162 641424 0 0 Unknown 2355 10320940 0 0 woff2 305 7368276 0 0 webp 168 1046464 0 0 jpg 348 58586336 0 0 ttf 48 70632 0 0 html 3096 100869256 0 0 css 1175 7062969 0 0 gif 28 125498 0 0 png 344 21995564 0 0 pdf 9 6904360 0 0 js 8128 35403970 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 2 /wp-content/uploads/2023/09/English-S-Kurane.pdf 6 8 5012300 /wp-content/uploads/2023/09/Faculty-S-Kurane-updated.pdf 3 1 1892060 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 10 macosx10 1 1 win7 67 8 android10 551 71 androidmarshmallow 10 10 macosx11 2 2 linux 6 6 win10 23738 14113 android 184 16 macosx6 4 4 Unknown 4426 4421 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 13 opera36.0.2130.46 2 2 chrome52.0.3624.98 10 10 chrome109.0.0.0 276 44 chrome117.0.0.0 2497 810 firefox47.0 2 2 chrome111.0.5563.116 184 16 chrome116.0.0.0 21526 13330 mozilla 19 14 Unknown 4407 4407 chrome104.0.0.0 4 4 chrome84.0.4147.105 55 6 chrome108.0.0.0 6 6 chrome39.0.2171.95 1 1 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 6 WordPress/6.3.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230930050425 WhatsApp/2.23.17.76_A 20230914134649 WhatsApp/2.23.20.0 20230927120431 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20230923185209 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20230912191821 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20230930050425 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 4 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20230923185209 WhatsApp/2.23.20.0 20230927120431 WhatsApp/2.23.17.76_A 20230914134649 WordPress/6.3.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230930050425 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 4505 4539 From1 0 0 From2 2 2 From3 137 137 From4 14008 24311 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 1 www_google_com 2 2 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 1 https://md-in-74.webhostbox.net:2083 137 137 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 7 302 144 48260 409 288 23904 503 2 2156 406 44 9944 301 182 538 404 111 3537723 206 8 1028296 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 10 /.well-known/security.txt 2 - /wp-emoji-release.min.js 1 - /wp-json/wp-block-editor/v1/url-details 1 https://testsahyadrimahavidyalay.ptechinstitute.com/wp-admin/post.php /wp-json/wp/v2/media/127 3 https://testsahyadrimahavidyalay.ptechinstitute.com/wp-admin/post.php /wp-content/themes/bizberg/assets/js/swiper.js.map 1 - /wp-json/oembed/1.0/proxy 1 https://testsahyadrimahavidyalay.ptechinstitute.com/wp-admin/post.php /wp-content/uploads/2023/07/updated-logo-2-e1694345607160.png 4 https://testsahyadrimahavidyalay.ptechinstitute.com/about/ /wp-content/uploads/2023/07/WhatsApp_Image_2023-07-18_at_18.34.33-removebg-preview-e1690266200260.png 95 https://testsahyadrimahavidyalay.ptechinstitute.com/department-of-english/ /wp-content/uploads/2023/07/hlogo-e1692705032697.png 1 https://testsahyadrimahavidyalay.ptechinstitute.com/library/ /admin/.env 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 57 115.96.208.162 12921 20348 240468581 20230929134137 216.10.248.154 4397 4397 5030218 20230930050425 117.223.172.49 348 390 8981901 20230910163638 117.223.172.248 227 618 7464368 20230909181100 117.223.174.162 164 409 4073436 20230903111857 103.176.135.76 123 562 8829010 20230914140515 106.213.80.51 117 426 11022652 20230902091338 103.176.135.78 115 430 16199130 20230927120637 117.223.174.19 43 193 1269569 20230912105434 103.176.135.77 36 209 9388143 20230914145155 152.57.176.202 10 95 5315912 20230913135003 49.44.80.234 8 67 1118109 20230915162446 152.57.109.136 6 41 0 20230908065945 152.57.165.250 6 47 394671 20230911062909 157.33.65.17 6 41 75846 20230904062554 157.33.201.31 6 89 4608868 20230914112740 35.213.227.163 6 55 651000 20230926113555 152.57.99.151 6 41 83198 20230907125042 152.57.107.41 6 41 83148 20230910075206 152.57.150.243 6 49 87343 20230910162739 152.57.163.149 6 91 4619131 20230914175003 152.57.97.246 6 43 0 20230908150904 152.57.136.111 6 89 4298390 20230911170842 157.33.213.54 5 19 75846 20230903211626 157.33.88.49 5 41 520395 20230903151244 205.210.31.183 2 2 377734 20230919230124 157.33.65.222 1 1 0 20230904065501 139.144.150.26 2 2 372596 20230910223400 157.33.78.33 3 11 3353174 20230903191441 167.248.133.190 2 3 88545 20230919225231 152.57.181.200 2 2 83734 20230913125559 143.110.249.208 2 2 83688 20230912131910 205.210.31.230 2 2 377734 20230923185209 167.94.145.56 2 3 88551 20230930050420 167.94.138.125 2 3 88545 20230919142518 159.203.182.222 2 2 376074 20230914050757 54.144.229.175 4 4 168786 20230918165531 46.101.8.159 2 2 84426 20230922181741 139.144.150.45 2 2 341770 20230903223233 87.236.176.221 2 2 83740 20230912191821 152.57.35.168 5 7 121854 20230908165656 152.57.119.122 2 14 3029291 20230907162158 152.57.211.178 2 2 84418 20230927120431 183.136.225.45 2 2 341770 20230904144638 157.33.94.253 0 21 0 45.12.3.13 2 2 84426 20230924205235 167.94.146.52 2 3 88537 20230925184707 147.182.130.98 2 2 374314 20230907131210 94.228.169.199 1 1 37948 20230906042409 152.57.113.48 2 6 143743 20230910083403 165.22.220.214 2 2 84418 20230926074816 152.57.167.153 2 2 56128 20230914134649 157.33.234.34 5 44 116301 20230901154840 87.236.176.36 0 1 4119 87.236.176.189 2 2 75958 20230905174328 206.81.1.88 2 2 376500 20230917005711 162.142.125.216 2 2 83740 20230913031502 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 28 20230901 33 136 575106 5 20230902 1614 2565 24741991 5 20230903 1343 2151 25162536 11 20230904 18 53 569308 5 20230905 309 592 4362580 3 20230906 1153 1515 16747378 7 20230907 288 785 15161168 6 20230908 52 253 522311 8 20230909 586 1263 12174690 9 20230910 2442 3449 36799869 13 20230911 12 136 4693061 2 20230912 1779 2531 34595194 10 20230913 2945 3577 53370652 9 20230914 1356 2235 40128257 13 20230915 685 1447 24133111 6 20230916 156 338 846737 9 20230917 280 652 8108916 6 20230918 2085 2350 8577678 3 20230919 9 11 639250 5 20230922 2 2 84426 1 20230923 2 2 377734 1 20230924 17 17 590976 3 20230925 293 535 5848321 6 20230926 702 893 2453865 5 20230927 34 123 8699167 3 20230928 68 153 135794 2 20230929 384 1210 16737221 2 20230930 5 6 172983 2 END_DAY # Session range - Number of visits BEGIN_SESSION 7 30s-2mn 5 30mn-1h 17 15mn-30mn 8 2mn-5mn 6 5mn-15mn 14 0s-30s 75 1h+ 35 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 242 /wp-admin/admin-ajax.php 7594 13512367 5 28 /wp-cron.php 4254 0 53 44 / 1483 50899723 57 46 /wp-json/jetpack/v4/jitm 502 13572 0 1 /department-of-english/ 270 9543285 4 4 /wp-json/wp/v2/pages 230 638077 0 0 /wp-admin/post.php 222 35343688 1 0 /wp-admin/edit.php 186 8896927 0 0 /wp-admin/nav-menus.php 166 15881552 0 0 /wp-json/wp/v2/blocks 159 3498 0 0 /wp-json/wp/v2/block-patterns/patterns 159 8419309 0 0 /wp-json/wp/v2/block-patterns/categories 159 102873 0 0 /wp-json/ 159 50085 0 0 /wp-json/wp/v2/taxonomies 133 319081 0 0 /wp-json/wp/v2/themes 133 164787 0 0 /wp-json/wp/v2/users 130 6326 0 0 /faculties-2/ 124 4293270 1 2 /principle-message/ 106 3662693 0 1 /about-collage/ 90 3161040 1 0 /about/ 88 3105609 0 1 /wp-json/elementor/v1/kit-elements-defaults 83 1826 0 0 /wp-json/elementor/v1/globals 82 20746 0 0 /wp-admin/post-new.php 82 11397217 0 0 /elementor-hf/header/ 80 1853222 0 0 /wp-json/wp/v2/taxonomies/category 79 72206 0 0 /wp-json/wp/v2/pages/997 2 3056 0 0 /wp-json/wp/v2/pages/496 4 6104 0 0 /wp-json/wp/v2/pages/1714 2 3069 0 0 /wp-json/wp/v2/pages/1523 2 3034 0 0 /teaching-faculties/ 6 199944 0 0 /wp-json/wp/v2/pages/1578 2 3041 0 0 /wp-content/plugins/elementor/assets/lib/eicons/fonts/eicons.woff2 38 1040720 1 0 /wp-json/wp/v2/pages/1641 1 2384 0 0 /wp-json/wp-block-editor/v1/url-details 6 748 0 0 /collage-development-committees/ 6 198078 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsg-1x4kaVQUwaEQXjN_mQ.woff 17 35112 0 0 /wp-json/wp/v2/pages/1694 2 3071 0 0 /alumni-feedback/ 2 56396 0 0 /wp-json/wp/v2/pages/1584 2 3042 0 0 /academics/ 2 56312 0 0 /wp-json/wp/v2/pages/1801 2 3036 0 0 /2018-19/ 2 56378 0 0 /wp-json/wp/v2/users/me 17 15528 0 0 /wp-json/wp/v2/pages/1492 4 6089 0 0 /wp-json/wp/v2/pages/988 2 3059 0 0 /wp-json/wp/v2/pages/1514 3 5414 0 0 /wp-json/wp/v2/posts 6 4442 0 0 /wp-admin/async-upload.php 31 20978 0 0 /wp-json/wp/v2/pages/1690 2 3033 0 0 /faculties-1/ 4 91874 0 0 /statutory-committee/ 6 197726 0 1 /notices-announcement/ 6 148913 0 1 /wp-json/wp/v2/block-renderer/core/archives 2 322 0 0 /wp-json/wp/v2/pages/6 6 14304 0 0 /infrastructure-2/ 12 427152 0 0 /wp-json/wp/v2/pages/1500 3 5417 0 0 /library/ 50 1790946 0 0 /rti/ 2 56172 0 0 /research-publications/ 2 55876 0 0 /wp-json/wp/v2/pages/1558 2 3045 0 0 /wp-json/wp/v2/pages/71 3 7152 0 0 /wp-admin/plugins.php 10 467038 0 0 /wp-json/wp/v2/pages/999 2 3053 0 0 /wp-json/wp/v2/pages/1702 2 3038 0 0 /wp-json/wp/v2/pages/1785 2 3036 0 0 /wp-admin/load-scripts.php 56 2645057 1 0 /student-feedback/ 4 141490 0 0 /wp-json/wp/v2/pages/1486 4 6093 0 0 /vision-mission/ 22 761994 0 0 /wp-json/wp/v2/pages/1723 2 3039 0 0 /wp-admin/widgets.php 2 257756 0 0 /wp-json/wp/v2/pages/907 2 4768 0 0 /department-of-hindi/ 42 1518112 0 0 /wp-json/wp/v2/pages/1720 3 5423 0 0 /sports/ 40 1394384 0 0 /wp-json/wp/v2/pages/990 2 3066 0 0 /wp-json/wp/v2/pages/1681 2 3046 0 0 /wp-json/wp/v2/pages/1629 2 3031 0 0 /wp-json/wp/v2/pages/1696 2 3041 0 0 /wp-json/wp/v2/pages/1592 2 3041 0 0 /wp-json/wp/v2/pages/1588 2 3041 0 0 /n-s-s/ 12 414870 0 0 /wp-json/wp/v2/pages/1727 2 3038 0 0 /wp-json/wp/v2/pages/1502 4 7822 0 0 /2023-2024/ 2 56398 0 0 /perspective-plan/ 2 56414 0 0 /wp-json/wp/v2/pages/1708 2 3050 0 0 /wp-json/wp/v2/pages/1725 2 3087 0 0 /wp-json/wp/v2/pages/1712 2 3060 0 0 /wp-admin/theme-install.php 1 34611 0 0 /wp-json/wp/v2/pages/1116 1 657 0 0 /wp-json/wp/v2/pages/1793 2 3053 0 0 /wp-json/wp/v2/pages/493 2 3057 0 0 /wp-json/wp/v2/pages/1484 4 6094 0 0 /wp-json/wp/v2/pages/1797 2 3040 0 0 /wp-json/wp/v2/pages/1791 2 3040 0 0 /wp-json/wp/v2/pages/1003 2 3062 0 0 /wp-json/wp/v2/pages/1319 1 646 0 0 /elementor-hf/footer/ 4 92660 0 0 /wp-json/wp/v2/pages/1698 2 3053 0 0 /wp-json/wp/v2/pages/1596 2 3039 0 0 /wp-json/wp/v2/categories 4 1160 0 0 /wp-admin/load-styles.php 28 4470485 0 0 /wp-json/wp/v2/pages/1498 3 5418 0 0 /wp-json/wp/v2/pages/1527 3 5420 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-regular-400.woff2 11 79656 1 1 /wp-content/plugins/header-footer-elementor/assets/fonts/hfe.ttf 48 70632 0 0 /wp-includes/js/tinymce/skins/lightgray/fonts/tinymce.woff 7 112944 0 0 /wp-json/wp/v2/pages/1722 1 2384 0 0 /wp-login.php 4 9111 1 0 /wp-json/wp/v2/navigation 7 9880 0 0 /wp-json/wp/v2/block-directory/search 10 11131 0 0 /wp-json/wp/v2/pages/490 2 3056 0 0 /wp-json/wp/v2/pages/877 1 2384 0 0 /wp-json/wp/v2/pages/1317 1 649 0 0 /wp-json/wp/v2/pages/1706 2 3037 0 0 /wp-json/wp/v2/pages/1651 2 3030 0 0 /wp-json/wp/v2/pages/451 18 30085 0 0 /2018-2019/ 4 112800 0 0 /academic-calendar/ 4 112224 0 1 /wp-json/wp/v2/pages/1598 2 3039 0 0 /chairmans-message/ 46 1604262 0 1 /wp-json/wp/v2/pages/1029 1 2384 0 0 /wp-json/wp/v2/pages/1525 2 3031 0 0 /wp-admin/admin.php 15 696352 1 0 /wp-json/wp/v2/taxonomies/post_tag 79 67466 0 0 /wp-content/plugins/bellows-accordion-menu/assets/css/fontawesome/fonts/fontawesome-webfont.woff2 23 322320 0 0 /cie/ 12 355059 2 1 /wp-json/wp/v2/pages/873 1 2384 0 0 /wp-content/plugins/smart-slider-3/Public/SmartSlider3/Application/Admin/Assets/fonts/Inter-SemiBold.woff2 11 766304 0 0 /admission-rules/ 12 396352 0 0 /wp-json/wp/v2/pages/1704 2 3087 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsg-1x4gaVQUwaEQXjM.woff 2 33440 0 0 /wp-json/wp/v2/block-renderer/core/latest-comments 2 506 0 0 /wp-json/wp/v2/pages/986 2 3059 0 0 /alumni/ 4 112256 0 0 /wp-json/wp/v2/pages/499 1 662 0 0 /department-of-marathi/ 48 1686693 0 0 /wp-json/wp/v2/pages/1637 2 3031 0 0 /wp-json/wp/v2/pages/1787 2 3061 0 0 /achievements-2/ 2 56298 0 0 /wp-json/wp/v2/pages/1635 2 3030 0 0 /wp-admin/plugin-install.php 2 65704 0 0 /social-media/ 4 112588 0 0 /wp-json/wp/v2/pages/995 2 3055 0 0 /scholarships/ 34 1163258 0 0 /wp-json/omapp/v1/notifications/ 1 686 0 0 /wp-json/wp/v2/pages/1353 1 650 0 0 /wp-json/wp/v2/pages/1716 2 3042 0 0 /wp-json/wp/v2/pages/1799 2 3086 0 0 /wp-json/wp/v2/posts/1 1 2722 0 0 /wp-admin/index.php 4 194696 0 0 /wp-json/wp/v2/pages/1649 2 3031 0 0 /wp-json/wp/v2/pages/1483 1 2384 0 0 /organogram-of-college/ 2 56444 0 0 /wp-json/wp/v2/pages/1653 2 3031 0 0 /wp-json/wp/v2/pages/1594 2 3041 0 0 /exam-schedule/ 4 141470 0 0 /certificate-courses/ 4 141496 0 0 /wp-admin/options-reading.php 1 33628 0 0 /wp-json/wp/v2/pages/1494 4 6107 0 0 /wp-json/wp/v2/pages/1692 2 3061 0 0 /wp-json/wp/v2/pages/1531 2 3034 0 0 /wp-admin/users.php 1 33161 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.woff2 65 1995864 0 11 /wp-json/wp/v2/pages/499/autosaves 4 1656 0 0 /wp-json/wp/v2/menus 3 1539 0 0 /wp-json/wp/v2/pages/1657 2 3030 0 0 /wp-content/plugins/wpforms-lite/assets/images/integrations/elementor/font/icon-wpforms.woff2 24 21056 0 0 /wp-admin/upload.php 4 194534 0 0 /wp-content/plugins/smart-slider-3/Public/SmartSlider3/Application/Admin/Assets/fonts/SmartSliderIcons.woff2 1 24592 0 0 /wp-json/wp/v2/pages/1590 2 3046 0 0 /aims-objectives/ 4 141446 0 0 /wp-json/wp/v2/pages/1655 2 3029 0 0 /news/ 4 112478 0 0 /wp-json/wp/v2/categories/1 79 22752 0 0 /wp-json/wp/v2/pages/1631 2 3031 0 0 /wp-admin/about.php 15 550541 0 0 /department-of-management/ 12 366680 1 2 /co-po-pso/ 2 56344 0 0 /wp-json/wp/v2/pages/1679 2 3048 0 0 /wp-json/wp/v2/pages/1718 2 3053 0 0 /wp-json/wp/v2/pages/1490 4 6089 0 0 /attendant/ 4 141250 0 0 /wp-json/wp/v2/pages/1582 2 3041 0 0 /women-development-cell/ 18 563894 2 3 /department-of-history/ 22 708739 0 0 /wp-json/wp/v2/pages/1488/autosaves 1 248 0 0 /wp-content/fonts/lato/S6u9w4BMUTPHh6UVSwiPGQ.woff2 57 391680 1 4 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsiH0B4kaVQUwaEQXjN_mQ.woff 17 36196 0 0 /wp-json/wp/v2/pages/1710 2 3032 0 0 /wp-json/wp/v2/pages/1496 3 5449 0 0 /wp-json/wp/v2/pages/1315 1 650 0 0 /wp-json/wp/v2/media 9 3705 0 0 /faculty-profile/ 4 141394 0 0 /cultural/ 24 785050 0 0 /wp-json/omapp/v1/notifications 19 14939 0 0 /wp-json/wp/v2/pages/435 1 693 0 0 /media/ 2 56072 0 0 /wp-json/wp/v2/pages/1679/autosaves 1 253 0 0 /wp-json/wp/v2/pages/1586 2 3041 0 0 /wp-content/fonts/poppins/pxiByp8kv8JHgFVrLGT9Z1xlE92JQEk.woff 35 93348 0 5 /principal/ 2 56358 0 1 /wp-json/wp-block-editor/v1/navigation-fallback 3 3177 0 0 /online-admission/ 78 2723650 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsjZ0B4gaVQUwaEQXjM.woff 67 294012 3 0 /wp-json/wp/v2/pages/1659 2 3030 0 0 /wp-json/wp/v2/pages/1803 2 3048 0 0 /wp-json/wp/v2/pages/1729 2 3050 0 0 /wp-admin/options-general.php 1 40861 0 0 /wp-json/wp/v2/pages/1521 2 3046 0 0 /wp-content/plugins/optinmonster/assets/fonts/fontawesome-webfont.woff2 1 77160 0 0 /bachelor-of-arts/ 8 254636 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-solid-900.woff2 3 234804 0 0 /wp-json/wp/v2/navigation/1414 5 7328 0 0 /procedures-and-polices-for-maintaining-and-utilizing-physical-academic-and-support-facilities/ 2 56704 0 0 /student-satisfaction-survey/ 4 141612 0 1 /wp-json/wp/v2/pages/1576 2 3040 0 0 /wp-json/wp/v2/pages/1488 4 6086 0 0 /wp-json/wp/v2/pages/1639 2 3029 0 0 /wp-json/wp/v2/pages/1795 2 3044 0 0 /wp-json/wp/v2/types/post 1 897 0 0 /wp-json/wp/v2/pages/1529 2 3041 0 0 /wp-json/wp/v2/pages/875 1 2384 0 0 /wp-content/plugins/smart-slider-3/Public/SmartSlider3/Application/Admin/Assets/fonts/Inter-Medium.woff2 4 381024 0 0 /wp-json/wp/v2/types 3 7606 0 0 /teachers-feedback/ 4 141530 0 0 /wp-json/wp/v2/pages/1789 2 3070 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsjZ0B4kaVQUwaEQXjN_mQ.woff 17 36372 0 0 /wp-json/wp/v2/pages/921 2 3054 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.woff2 67 2033096 5 0 /skill-oriented-value-oriented-short-term-course/ 4 143002 0 0 /wp-json/wp/v2/pages/1600 2 3044 0 0 /wp-json/wp/v2/pages/451/autosaves 9 3751 0 0 /scholarship/ 2 55944 1 0 /wp-json/wp/v2/pages/1633 2 3030 0 0 /cometitive-exam-guidance-cell/ 16 559334 0 0 /coordinator/ 2 56006 0 0 /wp-admin/ 67 3158121 18 0 /wp-admin/themes.php 7 295895 0 0 /alumni-2/ 2 56110 0 0 /wp-json/wp/v2/pages/1700 2 3038 0 0 END_SIDER