AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202409 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2706 POS_VISITOR 6484 POS_DAY 6629 POS_DOMAIN 3282 POS_LOGIN 3508 POS_ROBOT 3663 POS_WORMS 3960 POS_EMAILSENDER 4091 POS_EMAILRECEIVER 4234 POS_SESSION 6725 POS_SIDER 6871 POS_FILETYPES 4369 POS_DOWNLOADS 4465 POS_OS 4637 POS_BROWSER 4716 POS_SCREENSIZE 4780 POS_UNKNOWNREFERER 4854 POS_UNKNOWNREFERERBROWSER 4981 POS_ORIGIN 5103 POS_SEREFERRALS 5235 POS_PAGEREFS 5379 POS_SEARCHWORDS 5527 POS_KEYWORDS 5679 POS_MISC 2370 POS_ERRORS 5738 POS_CLUSTER 3364 POS_SIDER_404 5861 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20241001155710 34 6149 14150112192560 FirstTime 0 LastTime 20240929171207 LastUpdate 20241001182001 34 0 33 0 0 TotalVisits 2 TotalUnique 2 MonthHostsKnown 0 MonthHostsUnknown 2 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 FlashSupport 0 0 0 TotalMisc 0 0 0 QuickTimeSupport 0 0 0 JavascriptDisabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 JavaEnabled 0 0 0 RealPlayerSupport 0 0 0 PDFSupport 0 0 0 DirectorSupport 0 0 0 AddToFavourites 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 36 36 395921 1 0 0 0 68 70 814005 2 0 0 0 2 2 0 3 0 0 0 2 6 3196879 4 0 0 0 73 75 803456 5 0 0 0 35 35 397413 6 0 0 0 0 0 0 7 0 0 0 4 6 220 8 0 0 0 66 66 813785 9 0 0 0 6 9 1364842 10 0 0 0 8 8 0 11 0 0 0 66 66 803010 12 0 0 0 2 2 0 13 0 0 0 4 4 0 14 5 5 867 37 37 409219 15 0 0 0 0 0 0 16 0 0 0 2 2 0 17 9 9 14272 0 0 0 18 0 0 0 37 37 401035 19 0 0 0 8 8 0 20 0 0 0 8 10 220 21 0 0 0 2 5 1832257 22 0 0 0 35 37 405817 23 0 0 0 33 33 397413 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 1 us 14 14 15139 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 4 Go\-http\-client/ 56 17500 20240930185311 0 bingbot/ 10 1100 20240923011359 10 Googlebot/ 6 3197099 20240917213411 4 bot[\s_+:,\.\;\/\\-] 4 3196879 20240907032034 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 html 11 14554 0 0 php 3 585 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 2 /wp-content/uploads/2024/02/B.Ed-Syllabus-2017-18.pdf 2 0 2729244 /wp-content/uploads/2024/02/migrationform.pdf 2 0 3664074 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 Unknown 14 14 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 1 Unknown 14 14 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 1 Jetpack_by_WordPress.com 20240929171207 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Jetpack_by_WordPress.com 20240929171207 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 0 From1 0 0 From2 0 0 From3 0 0 From4 14 14 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 301 141 0 302 14 0 404 308 5619524 406 15 3390 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 12 /server 28 - /login.action 28 - /.git/config 28 - /telescope/requests 28 - /.vscode/sftp.json 14 - /_all_dbs 28 - /debug/default/view 28 - /v2/_catalog 28 - /config.json 14 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 28 - /.DS_Store 28 - /s/730323e2834323e20313e2631323/_/ 28 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 2 192.0.87.71 9 9 14272 20240929171207 192.0.102.14 5 5 867 20240909141629 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 2 20240909 5 5 867 1 20240929 9 9 14272 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 2 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 2 / 11 14554 1 1 /xmlrpc.php 3 585 1 1 END_SIDER