AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202409 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2048 POS_TIME 2720 POS_VISITOR 7399 POS_DAY 9274 POS_DOMAIN 3348 POS_LOGIN 3662 POS_ROBOT 3817 POS_WORMS 4064 POS_EMAILSENDER 4195 POS_EMAILRECEIVER 4338 POS_SESSION 9809 POS_SIDER 9956 POS_FILETYPES 4473 POS_DOWNLOADS 4591 POS_OS 4639 POS_BROWSER 4757 POS_SCREENSIZE 4975 POS_UNKNOWNREFERER 5049 POS_UNKNOWNREFERERBROWSER 5608 POS_ORIGIN 5975 POS_SEREFERRALS 6109 POS_PAGEREFS 6253 POS_SEARCHWORDS 6401 POS_KEYWORDS 6553 POS_MISC 2384 POS_ERRORS 6612 POS_CLUSTER 3518 POS_SIDER_404 6711 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20241005142212 1 0 17172612530303 FirstTime 20240901052834 LastTime 20240930122049 LastUpdate 20241005183604 1 0 0 0 0 TotalVisits 47 TotalUnique 43 MonthHostsKnown 0 MonthHostsUnknown 47 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 QuickTimeSupport 0 0 0 TotalMisc 0 0 0 PDFSupport 0 0 0 JavaEnabled 0 0 0 FlashSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 AddToFavourites 0 0 0 RealPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 DirectorSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 2 4 30185 1 3 226 1 6 12 90555 5 11 99236 2 2 4 30185 0 2 0 3 4 6 128479 0 0 0 4 4 8 60370 2 6 98294 5 8 17 227599 2 4 716 6 4 9 60861 0 4 0 7 10 11 351285 3 3 678 8 8 9 323329 0 0 0 9 2 2 98294 2 14 391649 10 8 9 323329 4 4 196588 11 2 3 28447 2 2 98294 12 6 8 84850 2 2 98294 13 2 3 28447 2 2 98294 14 4 5 126741 0 0 0 15 2 2 98294 0 0 0 16 6 13 267752 0 0 0 17 4 4 55912 0 16 5728 18 0 0 0 0 0 0 19 4 11 169458 0 0 0 20 8 15 295708 0 0 0 21 2 4 30185 4 4 126250 22 0 0 0 2 2 98294 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 7 us 52 78 1244458 cn 18 38 534991 ca 16 16 786352 be 4 8 60370 zz 4 14 227691 in 2 2 27956 nl 2 3 28447 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 no_user_agent 30 1178001 20240927104032 0 curl 2 98294 20240901013535 0 Go\-http\-client/ 2 27956 20240910214538 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 3 html 98 2424914 0 0 png 37 33131 0 0 js 24 452220 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 4 win10 39 32 macosx15 20 14 macosx 32 8 Unknown 68 44 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 8 Unknown 20 20 chrome96.0.4664.110 20 14 chrome124.0.0.0 2 2 chrome87.0.4280.88 32 8 mozilla 48 24 chrome126.0.0.0 25 18 opera60.0.3255.83 2 2 chrome100.0.4896.60 10 10 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 3 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20240929212824 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20240929060002 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240925080903 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240925080903 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 98 128 From1 0 0 From2 0 0 From3 0 0 From4 0 31 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 2 404 20 7160 406 5 1130 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 9 /vendor/swiper/swiper-bundle.min.js 2 - /vendor/purecounter/purecounter_vanilla.js 2 - /js/main.js 2 - //maxcdn.bootstrapcdn.com/bootstrap/3.4.1/js/bootstrap.min.js 2 - /vendor/bootstrap/js/bootstrap.bundle.min.js 2 - /vendor/glightbox/js/glightbox.min.js 2 - //ajax.googleapis.com/ajax/libs/jquery/3.6.3/jquery.min.js 2 - /vendor/php-email-form/validate.js 2 - /.git/config 4 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 47 35.171.144.152 6 6 294882 20240921082816 54.88.179.33 4 4 196588 20240921101029 123.160.223.73 4 5 56403 20240924080141 111.7.96.179 4 11 169458 20240903163439 23.145.40.147 4 14 227691 20240914195450 45.148.10.59 2 2 27956 20240922174647 68.183.114.80 2 3 28447 20240930122049 68.183.15.34 2 2 27956 20240902170912 206.168.34.43 2 4 30185 20240921014246 147.185.132.231 2 2 98294 20240925080903 167.94.145.111 2 4 30185 20240908042318 167.71.129.192 2 2 27956 20240901121904 206.168.34.50 2 4 30185 20240916002248 199.45.154.157 2 4 30185 20240901052834 198.235.24.37 2 2 98294 20240906161729 167.94.145.96 2 4 30185 20240929055959 87.236.176.50 2 2 27956 20240929212746 34.1.25.55 2 2 27956 20240913073758 46.101.87.254 2 3 28447 20240903140339 199.45.154.151 2 4 30185 20240917042320 111.7.96.157 2 3 28447 20240918072331 68.183.193.218 2 3 28447 20240911113917 167.94.145.110 2 4 30185 20240914011051 198.235.24.181 2 2 98294 20240904101954 199.45.155.92 2 4 30185 20240911022425 87.236.176.145 0 1 491 87.236.176.194 0 1 1738 123.160.223.74 2 10 162827 20240910053702 45.55.198.115 2 3 28447 20240916135704 146.190.50.219 2 3 28447 20240911105028 162.142.125.217 2 4 30185 20240914012553 205.210.31.241 2 2 98294 20240924104948 123.160.223.75 2 4 61453 20240910053703 205.210.31.249 2 2 98294 20240910143309 144.126.199.71 2 3 28447 20240925065541 198.235.24.94 2 2 98294 20240903204218 87.236.176.202 0 1 491 147.185.132.150 2 2 98294 20240920034836 87.236.176.248 2 2 27956 20240909035655 198.235.24.209 2 2 98294 20240911151249 162.142.125.47 2 4 30185 20240909060037 123.160.221.130 2 2 27956 20240907203330 174.138.34.5 2 3 28447 20240913121812 87.236.176.205 0 1 1738 123.160.223.72 2 3 28447 20240914195442 205.210.31.42 2 2 98294 20240907092042 198.235.24.172 2 2 98294 20240914074951 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 22 20240901 4 6 58141 2 20240902 2 2 27956 1 20240903 8 16 296199 3 20240904 2 2 98294 1 20240906 2 2 98294 1 20240907 8 15 295708 4 20240908 6 8 226773 2 20240909 4 8 60370 2 20240910 6 13 267752 3 20240911 8 12 185373 4 20240913 4 5 56403 2 20240914 10 21 328122 5 20240916 4 7 58632 2 20240917 2 4 30185 1 20240918 2 3 28447 1 20240920 2 2 98294 1 20240921 8 10 325067 4 20240922 2 2 27956 1 20240924 4 5 126741 2 20240925 4 5 126741 2 20240929 4 8 60370 2 20240930 2 3 28447 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 47 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 98 2424914 47 47 END_SIDER