AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202409 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2697 POS_VISITOR 7564 POS_DAY 7761 POS_DOMAIN 3353 POS_LOGIN 3591 POS_ROBOT 3746 POS_WORMS 4093 POS_EMAILSENDER 4224 POS_EMAILRECEIVER 4367 POS_SESSION 7922 POS_SIDER 8059 POS_FILETYPES 4502 POS_DOWNLOADS 4598 POS_OS 5409 POS_BROWSER 5510 POS_SCREENSIZE 5650 POS_UNKNOWNREFERER 5724 POS_UNKNOWNREFERERBROWSER 6065 POS_ORIGIN 6147 POS_SEREFERRALS 6277 POS_PAGEREFS 6421 POS_SEARCHWORDS 6569 POS_KEYWORDS 6721 POS_MISC 2361 POS_ERRORS 6780 POS_CLUSTER 3447 POS_SIDER_404 6904 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20241001025405 34 6216 13915196401994 FirstTime 0 LastTime 0 LastUpdate 20241001181948 34 0 33 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 5 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 TotalMisc 0 0 0 JavaEnabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 PDFSupport 0 0 0 FlashSupport 0 0 0 AddToFavourites 0 4 0 RealPlayerSupport 0 0 0 DirectorSupport 0 0 0 QuickTimeSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 1 77381 53 56 1515246 1 0 2 142634 41 54 1289586 2 0 0 0 68 78 1858777 3 0 0 0 35 37 904158 4 0 0 0 6 9 166983 5 0 1 42015 6 12 169449 6 0 0 0 0 0 0 7 0 0 0 14 16 83542 8 0 0 0 6 21 2308553 9 0 0 0 2 4 246 10 0 1 77381 2 8 208792 11 0 0 0 4 5 282406 12 0 0 0 0 6 568944 13 0 0 0 6 10 492 14 0 1 1156 35 44 1066092 15 0 0 0 105 110 2819778 16 0 0 0 8 12 411622 17 0 0 0 136 138 3581472 18 0 0 0 123 128 2902364 19 0 0 0 74 78 1693155 20 0 0 0 78 83 2312029 21 0 0 0 70 76 1806390 22 0 0 0 72 77 1998733 23 0 0 0 81 83 2044462 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 2 us 0 4 262030 in 0 2 78537 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 5 Go\-http\-client/ 110 35908 20240930233540 0 Googlebot/ 78 2239832 20240930122026 56 bot[\s_+:,\.\;\/\\-] 17 2308799 20240922133836 6 bingbot/ 15 492391 20240926202532 12 facebookexternalhit/ 8 984 20240929133217 8 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 png 1 1156 0 0 pdf 5 339411 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 11 /wp-content/uploads/2024/01/Faculty-Profile.pdf 7 0 294105 /wp-content/uploads/2024/01/Tejasvi-Bhandari-madam-FACULTY-PROFILE.pdf 6 0 997710 /wp-content/uploads/2024/01/Academic-Calender-2022-23.pdf 4 0 309524 /wp-content/uploads/2024/02/Marathi-Dr-Dipti-Shembekar-FACULTY-PROFILE.pdf 4 0 675828 /wp-content/uploads/2024/01/Department-of-English-CO.pdf 3 0 1206501 /wp-content/uploads/2024/01/Kadam-P.A.pdf 2 0 564812 /wp-content/uploads/2024/01/Academic-Calender-2018-19.pdf 2 0 130506 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 1 0 897689 /wp-content/uploads/2024/01/Academic-Calender-2021-22.pdf 1 0 72071 /wp-content/uploads/2024/01/Academic-Calender-2020-21.pdf 1 0 62444 /wp-content/uploads/2024/01/Academic-Calender-2019-20.pdf 1 0 71393 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 3 android10 2 0 Unknown 3 0 win10 1 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 4 chrome128.0.6613.113 1 0 chrome127.0.0.0 2 0 chrome129.0.0.0 1 0 chrome128.0.6613.137 2 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/128.0.6613.137_Safari/537.36 20240922010732 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/128.0.6613.113_Safari/537.36 20240906010235 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 3 From1 0 0 From2 0 0 From3 0 0 From4 0 3 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 301 260 0 302 12 0 404 611 24908577 406 30 6780 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 14 /config.json 28 - /_all_dbs 54 - /telescope/requests 56 - /server 54 - /.vscode/sftp.json 27 - /v2/_catalog 54 - /debug/default/view 54 - /s/730323e2834323e20313e2631323/_/ 56 - /login.action 54 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 54 - /aspera/faspex/ 2 - /my-account/ 4 - /.DS_Store 56 - /.git/config 58 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 5 157.48.171.96 0 1 77381 66.249.69.101 0 1 65253 66.249.68.37 0 2 119396 183.87.168.118 0 1 77381 115.98.232.13 0 1 1156 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 5 20240902 0 2 154762 0 20240906 0 1 65253 0 20240915 0 1 42015 0 20240922 0 1 77381 0 20240924 0 1 1156 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER