AWSTATS DATA FILE 8.0 (build 20240604) # If you remove this file, all statistics for date 202509 will be lost/reset. # Last config file used to build this data file was /home/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2118 POS_TIME 2789 POS_VISITOR 7828 POS_DAY 9255 POS_DOMAIN 3357 POS_LOGIN 3654 POS_ROBOT 3809 POS_WORMS 4120 POS_EMAILSENDER 4251 POS_EMAILRECEIVER 4394 POS_SESSION 9683 POS_FILESIZE 9918 POS_REQUESTTIME 10016 POS_SIDER 9840 POS_FILETYPES 4529 POS_DOWNLOADS 4611 POS_OS 4659 POS_BROWSER 4821 POS_SCREENSIZE 5209 POS_UNKNOWNREFERER 5283 POS_UNKNOWNREFERERBROWSER 5768 POS_ORIGIN 6034 POS_SEREFERRALS 6166 POS_PAGEREFS 6329 POS_SEARCHWORDS 6477 POS_KEYWORDS 6629 POS_MISC 2453 POS_ERRORS 6688 POS_CLUSTER 3510 POS_SIDER_404 6774 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20251001141852 1 0 5576754819113 FirstTime 20250901071708 LastTime 20250929200642 LastUpdate 20251002081108 1 0 0 0 0 TotalVisits 37 TotalUnique 36 MonthHostsKnown 0 MonthHostsUnknown 36 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 JavascriptDisabled 0 0 0 DirectorSupport 0 0 0 TotalMisc 0 0 0 RealPlayerSupport 0 0 0 JavaEnabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 PDFSupport 0 0 0 AddToFavourites 0 0 0 QuickTimeSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 5 5 2235 1 6 0 1 0 0 0 1 1 0 2 4 4 1788 16 19 0 3 3 3 1341 18 20 8046 4 0 0 0 10 11 4023 5 0 0 0 2 3 0 6 0 0 0 1 1 447 7 6 6 2682 2 6 447 8 2 2 894 2 4 0 9 2 2 894 1 5 447 10 3 3 1341 3 4 0 11 5 5 2235 3 8 447 12 2 2 894 1 4 0 13 1 1 447 3 3 894 14 0 0 0 0 0 0 15 0 0 0 15 15 0 16 2 2 894 2 6 447 17 0 0 0 16 16 447 18 13 13 5811 34 36 447 19 2 2 894 10 11 4023 20 4 4 1788 18 22 8046 21 0 0 0 1 1 0 22 2 2 894 0 2 0 23 1 1 447 20 23 8493 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 7 us 32 32 14304 in 11 11 4917 cn 5 5 2235 ca 4 4 1788 be 2 2 894 gb 2 2 894 ru 1 1 447 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 5 GPTBot/ 45 20115 20250925032602 0 bot[\s_+:,\.\;\/\\-] 29 12963 20250916230028 0 no_user_agent 5 2235 20250921173636 0 survey 2 894 20250910134037 0 scrapy 1 447 20250901132321 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 html 57 25479 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 8 macosx13 1 1 winxp 1 1 Unknown 24 24 macosx15 1 1 win7 15 15 win10 5 5 linux 8 8 androidoreo 2 2 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 17 chrome67.0.3396.99 1 1 chrome96.0.4664.110 1 1 chrome71.0.2623.112 2 2 chrome139.0.0.0 5 5 firefox139.0 2 2 msie6.0.2900.2180 1 1 netscape5.0 1 1 chrome63.0.3239.132 2 2 chrome63.0.3239.111 2 2 chrome138.0.7204.23 1 1 Unknown 7 7 chrome136.0.0.0 1 1 edge18 2 2 chrome120.0.0.0 1 1 mozilla 16 16 chrome91.0.4472.124 1 1 firefox47.0 11 11 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 5 Mozilla/5.0 20250902131609 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20250916112046 Hello_from_Palo_Alto_Networks,_find_out_more_about_our_scans_in_https://docs-cortex.paloaltonetworks.com/r/1/Cortex-Xpanse/Scanning-activity 20250929191539 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20250920033745 okhttp/4.9.2 20250927003830 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 2 okhttp/4.9.2 20250927003830 Hello_from_Palo_Alto_Networks,_find_out_more_about_our_scans_in_https://docs-cortex.paloaltonetworks.com/r/1/Cortex-Xpanse/Scanning-activity 20250929191539 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 56 56 From1 0 0 From2 1 1 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 1 www_google_com 1 1 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 1 404 115 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 40 /phpinfo.php 4 - /backend/.env 3 - /new/.env.local 1 - /phpinfo 4 - /_profiler/phpinfo/phpinfo.php 1 - /cron/.env 2 - /.env.example 3 - /new/.env 1 - /app/.env 1 - /admin/.env 3 - /www/.env 1 - /_phpinfo.php 1 - /new/.env.production 2 - /.env.prod 3 - /security.txt 1 - /api/.env 4 - /login 2 - /application/.env 3 - /_profiler/phpinfo/info.php 3 - /robots.txt 12 - /conf/.env 2 - /php_info.php 3 - / 3 - /info 3 - /dev/.env 4 - /favicon.png 1 - /vendor/phpunit/phpunit/src/Util/PHP/eval-stdin.php 1 - /portal/.env 1 - /.git/config 12 - /.well-known/security.txt 3 - /docker/.env 2 - /aws-secret.yaml 1 - /.env.save 3 - /new/.env.staging 2 - /.env 11 - /docker/app/.env 1 - /awstats/.env 1 - /env/.env 1 - /_profiler/phpinfo 4 - /wp-config 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 36 45.148.10.243 11 11 4917 20250920183142 115.231.78.8 4 4 1788 20250929200642 206.168.34.57 2 2 894 20250905072319 162.142.125.221 2 2 894 20250916112046 162.142.125.113 2 2 894 20250901120823 162.142.125.210 2 2 894 20250915082906 162.142.125.197 2 2 894 20250906162649 167.94.145.103 2 2 894 20250902002653 44.193.254.10 2 2 894 20250926100112 167.94.145.99 2 2 894 20250914181310 198.235.24.50 1 1 447 20250929191539 64.23.174.188 1 1 447 20250915093736 54.218.135.43 1 1 447 20250928072613 87.236.176.250 1 1 447 20250920033745 147.185.132.105 1 1 447 20250916021457 206.189.12.224 1 1 447 20250929032852 157.245.34.9 1 1 447 20250904021707 137.184.11.78 1 1 447 20250902023650 128.199.44.215 1 1 447 20250910090152 198.235.24.20 1 1 447 20250905232641 123.160.223.72 1 1 447 20250911224656 198.235.24.42 1 1 447 20250901204013 54.186.12.147 1 1 447 20250901071708 192.227.138.144 1 1 447 20250902072247 34.220.157.171 1 1 447 20250923114801 31.6.7.234 1 1 447 20250902131609 205.210.31.245 1 1 447 20250920031608 147.185.132.111 1 1 447 20250903001214 134.122.60.135 1 1 447 20250924020742 100.29.140.0 1 1 447 20250927003830 44.252.28.41 1 1 447 20250908202527 94.159.108.209 1 1 447 20250916223518 18.206.238.198 1 1 447 20250927003854 64.225.16.114 1 1 447 20250901104735 18.236.135.34 1 1 447 20250927075157 87.236.176.115 1 1 447 20250908191512 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 19 20250901 5 5 2235 4 20250902 5 5 2235 4 20250903 1 1 447 1 20250904 1 1 447 1 20250905 3 3 1341 2 20250906 2 2 894 1 20250908 2 2 894 2 20250910 1 1 447 1 20250911 1 1 447 1 20250914 2 2 894 1 20250915 3 3 1341 2 20250916 4 4 1788 3 20250920 13 13 5811 3 20250923 1 1 447 1 20250924 1 1 447 1 20250926 2 2 894 1 20250927 3 3 1341 3 20250928 1 1 447 1 20250929 6 6 2682 4 END_DAY # Session range - Number of visits BEGIN_SESSION 2 0s-30s 34 30s-2mn 3 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 57 25479 37 37 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 2 100-500 139 0-44 145 END_FILESIZE # Request Time Range - Request Time Frequency BEGIN_REQUESTTIME 0 END_REQUESTTIME