AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202310 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2720 POS_VISITOR 8806 POS_DAY 10651 POS_DOMAIN 3422 POS_LOGIN 3761 POS_ROBOT 3916 POS_WORMS 4155 POS_EMAILSENDER 4286 POS_EMAILRECEIVER 4429 POS_SESSION 11356 POS_SIDER 11562 POS_FILETYPES 4564 POS_DOWNLOADS 4936 POS_OS 5018 POS_BROWSER 5300 POS_SCREENSIZE 6024 POS_UNKNOWNREFERER 6098 POS_UNKNOWNREFERERBROWSER 6855 POS_ORIGIN 7454 POS_SEREFERRALS 7595 POS_PAGEREFS 7739 POS_SEARCHWORDS 7930 POS_KEYWORDS 8082 POS_MISC 2383 POS_ERRORS 8141 POS_CLUSTER 3617 POS_SIDER_404 8312 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20231101124848 9 1871 9163444843379 FirstTime 20231003125126 LastTime 20231031211926 LastUpdate 20231101181329 9 0 8 0 0 TotalVisits 94 TotalUnique 43 MonthHostsKnown 0 MonthHostsUnknown 44 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 RealPlayerSupport 0 0 0 TotalMisc 0 0 0 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 DirectorSupport 0 0 0 JavascriptDisabled 0 0 0 QuickTimeSupport 0 0 0 JavaEnabled 0 0 0 AddToFavourites 0 22 0 PDFSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 4 4 755474 0 0 0 1 4 4 462198 0 0 0 2 23 23 1430990 4 4 755498 3 22 247 7483900 0 9 747 4 12 12 631054 2 138 433262 5 2 2 84438 0 0 0 6 3 3 84438 2 6 377988 7 0 0 0 0 0 0 8 7 8 257411 4 6 377670 9 9 10 257433 0 6 260 10 11 59 427309 0 0 0 11 475 1263 12099772 12 71 40623 12 159 412 4222815 8 8 377746 13 28 66 921452 0 20 1660 14 2 2 84442 0 0 0 15 10 13 379874 0 5 83301 16 116 463 16419914 2 34 108542 17 33 146 2213949 4 46 406181 18 33 118 5745035 191 203 35196 19 2 2 84442 0 0 0 20 5 6 172993 2 4 377752 21 5 6 172959 0 2 0 22 17 18 888495 0 2 0 23 0 0 0 2 2 377748 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 8 in 492 1860 27788905 us 433 838 16371248 ca 32 32 5163956 jp 16 148 5618926 ru 3 3 84438 vn 2 2 84438 au 2 2 84438 no 2 2 84438 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 no_user_agent 18 3399616 20231030081653 0 unknown 4 520 20231008093813 4 Konqueror/ 2 716 20231009183103 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 17 woff 22 525136 0 0 webp 44 425860 0 0 gif 2 18894 0 0 Unknown 33 7836 0 0 yml 4 1432 0 0 js 1343 7826431 0 0 php 568 2230189 0 0 csv 1 358 0 0 css 379 2374382 0 0 d 1 358 0 0 html 289 14451788 0 0 ttf 10 1347032 0 0 ini 1 358 0 0 png 72 6779749 0 0 woff2 54 2331556 0 0 svg 11 11405 0 0 jpg 53 16948023 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 1 /opt/data/secrets/aws.csv 1 0 358 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 16 winme 2 1 macosx10 2 2 win7 64 2 androidnougat 2 2 macosx14 2 2 linux 262 32 androidpie 1 0 linuxubuntu 2 2 winxp 4 4 androidoreo 2 2 Unknown 398 393 android10 102 15 win8 2 2 android 6 6 win10 2034 515 macosx12 2 2 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 32 chrome55.0.2859.0 2 2 mozilla 15 10 chrome79.0.3945.79 127 18 chrome75.0.3770.142 2 2 chrome76.0.3809.111 1 0 chrome108.0.0.0 9 9 chrome69.0.3497.100 2 2 opera7.50 2 2 vodafone 2 2 Unknown 381 381 chrome75.0.3770.100 2 2 firefox27.3 2 2 chrome83.0.4103.61 62 0 firefox67.0 2 2 chrome101.0.4951.61 2 2 chrome118.0.0.0 574 74 msie5.5 2 1 chrome116.0.0.0 4 4 chrome103.0.5060.114 4 4 chrome20.0.1090.0 2 2 chrome117.0.0.0 1432 432 chrome36.0.1985.67 2 2 chrome74.0.3729.157 1 0 chrome117.0.5938.88 237 12 opera85.0.4341.79 2 2 chrome59.0.3071.125 2 2 chrome86.0.4240.183 1 1 chrome110.0.0.0 4 4 chrome100.0.4896.75 2 2 opera62.0.3331.72 2 2 chrome62.0.3191.0 1 0 msie11.0 2 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 7 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20231031162906 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20231031211926 HTMLParser/1.6 20231009183103 WhatsApp/2.23.20.0 20231009161236 WordPress/6.3.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231031211926 WordPress/6.3.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231013113349 Vodafone/1.0/V802SE/SEJ001_Browser/SEMC-Browser/4.1 20231009183103 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 5 WordPress/6.3.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231031211926 WordPress/6.3.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231013113349 WhatsApp/2.23.20.0 20231009161236 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20231031162906 HTMLParser/1.6 20231009183103 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 464 468 From1 0 0 From2 0 0 From3 13 13 From4 505 2406 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 1 https://md-in-74.webhostbox.net:2083 13 13 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 8 302 18 0 406 10 2260 404 7 194375 500 90 32220 409 73 6059 301 307 0 503 11 11858 206 4 106550 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 3 /static/admin/javascript/hetong.js 2 https://www.testsahyadrimahavidyalay.ptechinstitute.com/static/admin/javascript/hetong.js /wp-emoji-release.min.js 4 - /Public/home/js/check.js 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 44 115.96.208.162 422 1538 13629176 20231029172955 216.10.248.154 351 351 3546441 20231031211926 103.176.135.79 40 114 1120849 20231011161150 42.107.81.209 22 114 7786227 20231009162223 18.218.17.154 18 19 6802 20231009183104 205.169.39.149 18 124 3948863 20231008110307 103.31.40.20 14 146 5534488 20231026100552 65.154.226.166 12 237 6852838 20231029035534 103.176.135.78 8 94 5252653 20231007162210 47.242.224.70 4 4 168872 20231008204453 15.236.95.194 4 4 168872 20231009041130 198.235.24.100 4 4 755492 20231022044226 45.12.3.13 4 4 168858 20231018171637 13.58.59.50 4 7 211008 20231025151813 167.94.145.56 2 3 88557 20231008092322 198.235.24.90 2 2 377732 20231031162906 198.235.24.154 2 2 377746 20231026000921 195.211.77.142 2 2 84438 20231008033556 198.235.24.196 2 2 377752 20231029013011 205.210.31.67 2 2 377748 20231011224808 205.210.31.228 2 2 377752 20231027022647 199.45.154.48 2 3 88539 20231031211922 171.244.43.14 2 2 84438 20231008093814 198.235.24.123 2 2 377748 20231003125126 205.210.31.75 2 2 377728 20231017184335 143.244.47.72 2 2 84438 20231008033516 205.169.39.246 0 65 602611 205.210.31.37 2 2 377746 20231025110049 159.223.207.12 2 2 84442 20231024192359 167.248.133.52 2 3 88557 20231005223853 152.57.20.199 2 2 84436 20231009161236 167.248.133.189 2 3 88557 20231004204340 47.254.74.59 2 2 84436 20231008153628 172.234.49.237 2 2 0 20231008040328 159.203.168.113 2 2 84438 20231010125810 195.211.77.140 1 1 0 20231008033536 205.210.31.48 2 2 377748 20231008035405 198.235.24.171 2 2 377728 20231018020700 167.248.133.123 2 3 88555 20231019084235 139.59.56.90 2 2 84438 20231006094705 133.242.174.119 2 2 84438 20231008063557 193.138.7.156 2 2 84438 20231008033513 47.88.101.3 2 2 84436 20231008153629 198.235.24.201 2 2 377728 20231015005814 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 27 20231003 2 2 377748 1 20231004 48 149 819524 4 20231005 14 15 510747 2 20231006 4 4 168876 2 20231007 11 97 5337091 2 20231008 204 624 10894794 21 20231009 91 222 8911440 11 20231010 77 169 758958 4 20231011 69 238 3035758 5 20231012 203 443 4375948 2 20231013 67 152 473673 2 20231014 5 5 84420 3 20231015 2 2 377728 1 20231017 2 2 377728 1 20231018 7 7 546568 3 20231019 50 153 1358151 4 20231020 10 10 422230 1 20231021 2 2 377746 1 20231022 25 178 3066513 4 20231023 4 4 168884 2 20231024 2 2 84442 1 20231025 15 102 5864817 4 20231026 13 61 805055 3 20231027 14 14 799962 2 20231029 32 220 4646875 4 20231030 2 2 84420 1 20231031 7 8 550691 3 END_DAY # Session range - Number of visits BEGIN_SESSION 7 15mn-30mn 7 30s-2mn 3 30mn-1h 3 0s-30s 66 2mn-5mn 4 5mn-15mn 5 1h+ 6 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 57 /wp-admin/admin-ajax.php 281 195902 0 8 /wp-cron.php 258 0 29 20 / 195 11571732 52 53 /department-of-english/ 30 1015042 0 1 /about/ 20 704894 0 0 /wp-json/jetpack/v4/jitm 18 396 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.woff2 13 860156 1 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsjZ0B4gaVQUwaEQXjM.woff 13 121044 0 2 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.woff2 13 844404 1 1 /wp-content/fonts/lato/S6u9w4BMUTPHh6UVSwiPGQ.woff2 13 161280 1 1 /wp-admin/load-scripts.php 11 382996 0 0 /wp-json/omapp/v1/notifications 9 6174 0 0 /wp-content/plugins/elementor/assets/lib/eicons/fonts/eicons.woff2 9 284160 0 0 /wp-admin/ 9 432452 8 0 /cgi-sys/500.html 9 3222 0 1 /wp-admin/load-styles.php 5 703752 0 0 /wp-content/fonts/poppins/pxiByp8kv8JHgFVrLGT9Z1xlE92JQEk.woff 5 20744 0 1 /faculties-2/ 4 121220 1 1 /wp-admin/post.php 4 598842 0 0 /co-po-pso/ 4 112704 0 1 /elementor-hf/header/ 4 92688 0 0 /wp-admin/edit.php 3 136665 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-regular-400.woff2 2 26552 0 0 /wp-json/elementor/v1/globals 2 506 0 0 /wp-json/elementor/v1/kit-elements-defaults 2 44 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-solid-900.woff2 1 78268 0 0 /magento/app/etc/env.php 1 358 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-brands-400.woff2 1 76736 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-solid-900.ttf 2 405488 0 1 /wp-content/plugins/wpforms-lite/assets/images/integrations/elementor/font/icon-wpforms.woff2 1 0 0 0 /staff-list/ 2 56292 0 0 /principle-message/ 2 59646 0 1 /test/config/secrets.yml 1 358 0 0 /wp-admin/upgrade.php 1 21 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.woff 1 101652 0 0 /wp-content/plugins/bellows-accordion-menu/assets/css/fontawesome/fonts/fontawesome-webfont.woff2 1 0 0 0 /wp-admin/plugins.php 2 90801 0 0 /department-of-commerce/ 2 56442 0 1 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-solid-900.woff 1 101648 0 0 /wp-content/plugins/header-footer-elementor/assets/fonts/hfe.ttf 2 0 0 0 /etc/aws-config/credentials.yml 1 358 1 0 /usr/local/etc/aws/credentials.yml 1 358 0 0 /v1/tasks 1 358 0 0 /jenkins/config/jenkins.properties 1 358 0 0 /app/config/aws-credentials.yml 1 358 0 0 /jenkins/secrets/whitelisted-callables.d 1 358 0 0 /departmental-blogs/ 2 56324 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.ttf 2 405488 0 0 /code-of-conduct/ 2 56428 0 0 /activates/ 2 56284 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-brands-400.woff 1 89988 0 0 /var/private/secrets.ini 1 358 0 0 /wp-admin/nav-menus.php 2 120852 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.ttf 2 268080 0 0 /right-to-information-act-rti/ 2 56418 0 1 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-brands-400.ttf 2 267976 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.woff 1 90060 0 0 END_SIDER