AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202410 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2691 POS_VISITOR 8734 POS_DAY 8936 POS_DOMAIN 3373 POS_LOGIN 3640 POS_ROBOT 3795 POS_WORMS 4049 POS_EMAILSENDER 4180 POS_EMAILRECEIVER 4323 POS_SESSION 9079 POS_SIDER 9216 POS_FILETYPES 4458 POS_DOWNLOADS 4557 POS_OS 5288 POS_BROWSER 5390 POS_SCREENSIZE 5501 POS_UNKNOWNREFERER 5575 POS_UNKNOWNREFERERBROWSER 5788 POS_ORIGIN 5870 POS_SEREFERRALS 6000 POS_PAGEREFS 6144 POS_SEARCHWORDS 6292 POS_KEYWORDS 6444 POS_MISC 2355 POS_ERRORS 6503 POS_CLUSTER 3496 POS_SIDER_404 6618 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20241101015811 1 0 14089813845780 FirstTime 0 LastTime 0 LastUpdate 20241101181924 1 0 0 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 5 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 RealPlayerSupport 0 0 0 FlashSupport 0 0 0 TotalMisc 0 0 0 JavascriptDisabled 0 0 0 DirectorSupport 0 0 0 JavaEnabled 0 0 0 PDFSupport 0 0 0 AddToFavourites 0 8 0 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 68 75 2103937 1 0 1 166285 70 72 1817652 2 0 0 0 46 61 2342198 3 0 0 0 114 124 3130066 4 0 0 0 75 78 1862793 5 0 0 0 38 42 1490602 6 0 0 0 6 6 167248 7 0 0 0 75 82 1984417 8 0 0 0 67 70 2171762 9 0 0 0 72 80 1970421 10 0 0 0 49 52 1459001 11 0 0 0 10 13 166531 12 0 2 898845 12 18 416686 13 0 0 0 40 43 904392 14 0 0 0 77 103 3091649 15 0 1 209148 39 40 1145637 16 0 2 962942 35 47 1127575 17 0 0 0 121 128 4534926 18 0 0 0 45 48 994026 19 0 0 0 36 38 1036513 20 0 0 0 34 44 1699191 21 0 0 0 47 52 1817552 22 0 0 0 9 10 249909 23 0 0 0 0 3 208717 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 4 in 0 2 210304 jp 0 1 897689 us 0 2 231538 cn 0 1 897689 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 Googlebot/ 121 7454237 20241031134224 72 Go\-http\-client/ 108 35316 20241031053641 0 bingbot/ 10 167269 20241026202425 8 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 png 2 210304 0 0 pdf 4 2026916 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 10 /wp-content/uploads/2024/01/Tejasvi-Bhandari-madam-FACULTY-PROFILE.pdf 18 0 2993130 /wp-content/uploads/2024/01/Department-of-English-CO.pdf 8 0 3217336 /wp-content/uploads/2024/01/Faculty-Profile.pdf 4 0 168060 /wp-content/uploads/2024/01/Academic-Calender-2018-19.pdf 4 0 261012 /wp-content/uploads/2024/01/Academic-Calender-2019-20.pdf 4 0 285572 /wp-content/uploads/2024/01/Academic-Calender-2021-22.pdf 3 0 216213 /wp-content/uploads/2024/01/Academic-Calender-2022-23.pdf 3 0 232143 /wp-content/uploads/2024/01/Academic-Calender-2020-21.pdf 3 0 187332 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 2 0 1795378 /wp-content/uploads/2024/01/Kadam-P.A.pdf 1 0 282406 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 3 Unknown 2 0 ios_iphone 2 0 win10 2 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 3 chrome129.0.0.0 2 0 safari13.0.3 2 0 chrome129.0.6668.89 2 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 1 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/129.0.6668.89_Safari/537.36 20241013161246 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 4 From1 0 0 From2 0 0 From3 0 0 From4 0 2 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 3 406 38 8588 301 300 0 404 744 30227991 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 76 /login.action 54 - /.DS_Store 54 - /images../.git/config 2 - /.aws/credentials 2 - /template/.git/config 2 - /config.json 27 - /.vscode/sftp.json 27 - /backend/.git/config 2 - /drupal/sites/.git/config 2 - /resources/.git/config 2 - /files/.git/config 2 - /shared/.git/config 2 - /.env_exemple 2 - /wp-content/.git/config 2 - /database/.git/config 2 - /sitemap.xml.gz 3 - /common/.git/config 2 - /public/.git/config 2 - /content../.git/config 2 - /panel/.git/config 2 - /sendgrid.env 2 - /debug/default/view 54 - /server 54 - /app/.git/config 2 - /source/.git/config 2 - /data/.git/config 2 - /dist/.git/config 2 - /lib../.git/config 2 - /v2/_catalog 54 - /modules/.git/config 2 - /phpinfo 2 - /bower_components/.git/config 2 - /src/.git/config 2 - /js../.git/config 2 - /templates/.git/config 2 - /static../.git/config 2 - /sitemap_index.xml 4 - /api/.git/config 2 - /php_info 2 - /admin/.git/config 2 - /phpinfo.php 2 - /documentation/.git/config 2 - /assets../.git/config 2 - /.git/config 74 - /prestashop/.git/config 2 - /lib/.git/config 2 - /css../.git/config 2 - /views/.git/config 2 - /s/730323e2834323e20313e2631323/_/ 54 - /js/libs/.git/config 2 - /media../.git/config 2 - /plugins/.git/config 2 - /node_modules/.git/config 2 - /extensions/.git/config 2 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 54 - /uploads/.git/config 2 - /sitemap.txt 2 - /config/.git/config 2 - /img../.git/config 2 - /.env.exemple 1 - /vendor/.git/config 2 - /docs/.git/config 2 - /media/uploads/.git/config 2 - /_profiler/phpinfo 2 - /_all_dbs 54 - /layout/.git/config 2 - /events../.git/config 2 - /info 2 - /info.php 2 - /env/.git/config 2 - /_profiler/phpinfo.php 2 - /themes/.git/config 2 - /php_info.php 2 - /scripts/.git/config 2 - /telescope/requests 54 - /cache/.git/config 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 5 115.98.234.190 0 2 210304 43.130.16.140 0 1 897689 49.51.183.220 0 1 897689 66.249.79.224 0 1 166285 66.249.79.237 0 1 65253 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 4 20241001 0 1 897689 0 20241009 0 3 376589 0 20241012 0 1 897689 0 20241013 0 1 65253 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER