AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202411 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2048 POS_TIME 2720 POS_VISITOR 7739 POS_DAY 9114 POS_DOMAIN 3357 POS_LOGIN 3654 POS_ROBOT 3809 POS_WORMS 4050 POS_EMAILSENDER 4181 POS_EMAILRECEIVER 4324 POS_SESSION 9562 POS_SIDER 9719 POS_FILETYPES 4459 POS_DOWNLOADS 4592 POS_OS 4640 POS_BROWSER 4789 POS_SCREENSIZE 5064 POS_UNKNOWNREFERER 5138 POS_UNKNOWNREFERERBROWSER 5697 POS_ORIGIN 6064 POS_SEREFERRALS 6197 POS_PAGEREFS 6341 POS_SEARCHWORDS 6489 POS_KEYWORDS 6641 POS_MISC 2384 POS_ERRORS 6700 POS_CLUSTER 3510 POS_SIDER_404 6802 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20241201073943 1 0 10638850606069 FirstTime 20241102120122 LastTime 20241127163441 LastUpdate 20241201183028 1 0 0 0 0 TotalVisits 33 TotalUnique 31 MonthHostsKnown 0 MonthHostsUnknown 34 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 TotalMisc 0 0 0 JavascriptDisabled 0 0 0 JavaEnabled 0 0 0 DirectorSupport 0 0 0 QuickTimeSupport 0 0 0 AddToFavourites 0 0 0 FlashSupport 0 0 0 RealPlayerSupport 0 0 0 PDFSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 2 2 716 1 2 4 30185 1 1 226 2 6 7 295373 8 28 1176379 3 4 7 151398 1 3 942 4 2 2 27956 0 46 16468 5 6 12 194917 7 9 2110 6 4 5 126741 0 0 0 7 4 5 126741 2 2 716 8 0 0 0 0 0 0 9 0 0 0 4 4 1168 10 2 2 98294 4 4 98746 11 2 3 28447 0 0 0 12 10 15 142235 3 3 98520 13 4 6 56894 6 54 46572 14 4 6 128479 10 30 1273957 15 0 0 0 2 2 98294 16 10 16 216805 0 30 8592 17 2 2 98294 6 48 1183539 18 0 0 0 0 0 0 19 0 0 0 0 0 0 20 4 11 169458 0 0 0 21 4 4 126250 2 26 9308 22 2 2 98294 4 4 196588 23 0 0 0 21 21 7386 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 6 us 44 63 1052624 cn 14 29 584373 ca 8 8 393176 sc 2 2 27956 be 2 4 30185 au 2 3 28447 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 no_user_agent 84 4114605 20241130145222 0 Screaming[\x20]Frog[\x20]SEO[\x20]Spider/ 2 27956 20241117135115 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 4 js 6 113055 0 0 png 26 20248 0 0 css 5 62648 0 0 html 72 1920810 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 7 macosx15 3 2 win10 8 8 win7 20 12 linux 30 20 macosx 10 4 Unknown 36 24 android 2 2 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 11 Unknown 12 12 safari1.2.2 2 2 chrome101.0.4951.41 2 2 chrome129.0.0.0 30 20 chrome100.0.4896.60 8 8 safari7.0 2 2 chrome63.0.3239.132 12 4 mozilla 24 12 chrome87.0.4280.88 8 2 chrome71.0.2623.112 6 6 chrome96.0.4664.110 3 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 3 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20241116140620 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20241121012506 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20241127163444 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20241116140620 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 72 93 From1 0 0 From2 0 0 From3 0 0 From4 0 16 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 2 406 11 2486 404 210 75180 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 22 /.git/config 14 - /vendor/swiper/swiper-bundle.min.js 21 - //ajax.googleapis.com/ajax/libs/jquery/3.6.3/jquery.min.js 21 - /phpinfo 2 - /php_info.php 2 - /sendgrid.env 2 - /.env.exemple 1 - /robots.txt 4 - /info.php 2 - /_profiler/phpinfo.php 2 - /vendor/bootstrap/js/bootstrap.bundle.min.js 21 - /php_info 2 - //maxcdn.bootstrapcdn.com/bootstrap/3.4.1/js/bootstrap.min.js 21 - /config.json 1 - /vendor/glightbox/js/glightbox.min.js 21 - /_profiler/phpinfo 4 - /.aws/credentials 2 - /rest/V1/products 2 - /js/main.js 21 - /phpinfo.php 4 - /vendor/php-email-form/validate.js 20 - /vendor/purecounter/purecounter_vanilla.js 20 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 34 115.231.78.8 6 11 263517 20241127050428 115.231.78.2 4 7 151398 20241103032626 35.171.144.152 4 4 196588 20241108025734 54.88.179.33 4 4 196588 20241120161125 162.142.125.198 2 4 30185 20241127163442 157.230.30.149 2 3 28447 20241116122320 159.65.200.178 2 3 28447 20241102120122 3.128.26.192 2 2 27956 20241112165810 162.142.125.197 2 4 30185 20241118055402 134.209.177.185 2 3 28447 20241120063531 123.160.223.73 2 2 27956 20241122200622 167.94.146.52 2 4 30185 20241124144212 165.232.82.199 2 3 28447 20241125133241 206.168.34.63 2 4 30185 20241116165324 167.94.138.56 2 4 30185 20241118161108 147.185.132.255 2 2 98294 20241112071217 205.210.31.141 2 2 98294 20241116140620 45.200.148.16 2 2 27956 20241109214412 198.235.24.86 2 2 98294 20241113102522 198.235.24.202 2 2 98294 20241108215739 64.227.23.25 2 3 28447 20241118115152 139.59.185.103 2 3 28447 20241110125421 147.185.132.25 2 2 98294 20241108062412 123.160.223.75 2 7 138966 20241122200625 198.235.24.16 2 2 98294 20241115220700 87.236.176.31 0 1 1738 123.160.223.74 0 2 2536 87.236.176.208 2 2 27956 20241121012505 165.22.65.87 2 3 28447 20241106123007 159.223.215.42 2 3 28447 20241106070206 52.15.174.192 2 2 27956 20241118041614 143.110.212.96 2 3 28447 20241111132450 165.22.206.209 2 3 28447 20241108122443 87.236.176.7 0 1 491 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 18 20241102 2 3 28447 1 20241103 4 7 151398 1 20241106 4 6 56894 2 20241108 12 13 519917 5 20241109 2 2 27956 1 20241110 2 3 28447 1 20241111 2 3 28447 1 20241112 4 4 126250 2 20241113 2 2 98294 1 20241115 2 2 98294 1 20241116 6 9 156926 3 20241118 8 13 116773 4 20241120 4 5 126741 2 20241121 2 4 30185 1 20241122 4 11 169458 2 20241124 2 4 30185 1 20241125 2 3 28447 1 20241127 8 15 293702 3 END_DAY # Session range - Number of visits BEGIN_SESSION 2 30s-2mn 2 0s-30s 31 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 72 1920810 33 33 END_SIDER