AWSTATS DATA FILE 8.0 (build 20240604) # If you remove this file, all statistics for date 202511 will be lost/reset. # Last config file used to build this data file was /home/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2118 POS_TIME 2792 POS_VISITOR 9702 POS_DAY 11410 POS_DOMAIN 3393 POS_LOGIN 3700 POS_ROBOT 3855 POS_WORMS 4205 POS_EMAILSENDER 4336 POS_EMAILRECEIVER 4479 POS_SESSION 11916 POS_FILESIZE 12151 POS_REQUESTTIME 12249 POS_SIDER 12073 POS_FILETYPES 4614 POS_DOWNLOADS 4696 POS_OS 4744 POS_BROWSER 4913 POS_SCREENSIZE 5461 POS_UNKNOWNREFERER 5535 POS_UNKNOWNREFERERBROWSER 5992 POS_ORIGIN 6230 POS_SEREFERRALS 6362 POS_PAGEREFS 6506 POS_SEARCHWORDS 6654 POS_KEYWORDS 6806 POS_MISC 2456 POS_ERRORS 6865 POS_CLUSTER 3556 POS_SIDER_404 6961 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20251201002237 5 803 10564260194062 FirstTime 20251101000756 LastTime 20251130144712 LastUpdate 20251201070312 5 0 4 0 0 TotalVisits 48 TotalUnique 44 MonthHostsKnown 0 MonthHostsUnknown 44 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 DirectorSupport 0 0 0 TotalMisc 0 0 0 JavascriptDisabled 0 0 0 PDFSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 QuickTimeSupport 0 0 0 JavaEnabled 0 0 0 RealPlayerSupport 0 0 0 AddToFavourites 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 1 1 447 1 1 0 1 3 3 1341 10 15 4470 2 2 2 894 10 14 4023 3 6 6 2235 24 29 8046 4 4 4 1788 2 5 322 5 3 3 1341 1 3 0 6 1 1 447 22 24 8493 7 2 2 894 1 3 447 8 1 1 447 2 3 0 9 9 9 4023 66 67 3576 10 0 0 0 1 1 447 11 5 5 2235 3 8 447 12 2 2 894 4 6 447 13 3 3 894 6 9 0 14 5 5 1788 5 7 447 15 1 1 447 4 4 0 16 3 3 1341 17 20 6258 17 2 2 894 2 4 894 18 1 1 447 3 5 447 19 1 1 447 1 1 0 20 3 3 1341 10 13 4470 21 2 2 894 15 20 5239 22 7 7 3129 97 104 12069 23 1 1 447 10 13 4023 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 8 us 42 42 17880 in 9 9 4023 ru 4 4 1341 ca 4 4 1788 cn 4 4 1788 de 2 2 894 gb 2 2 894 za 1 1 447 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 6 GPTBot/ 130 58110 20251129223253 0 no_user_agent 5 2235 20251118094335 0 bot[\s_+:,\.\;\/\\-] 2 894 20251111011950 0 survey 2 894 20251114215328 0 scrapy 2 894 20251128141546 0 Go\-http\-client/ 2 894 20251109172449 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 html 68 29055 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 8 win7 14 14 win10 24 24 androidoreo 2 2 linux 6 6 macosx15 3 3 ios_iphone 4 4 Unknown 14 14 macosx13 1 1 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 25 chrome108.0.0.0 2 2 chrome63.0.3239.132 2 2 chrome99.0.4859.172 6 6 edge18 3 3 chrome139.0.0.0 3 3 mozilla 8 8 chrome73.0.3683.103 1 1 chrome113.0.0.0 2 2 safari14.0.3 4 4 chrome138.0.0.0 1 1 Unknown 5 5 chrome71.0.2623.112 2 2 chrome126.0.0.0 2 2 firefox139.0 2 2 chrome85.0.4183.102 1 1 chrome137.0.0.0 1 1 netscape5.0 1 1 chrome63.0.3239.111 2 2 chrome91.0.4472.124 4 4 chrome134.0.0.0 3 3 firefox47.0 9 9 chrome67.0.3396.99 1 1 chrome112.0.0.0 1 1 chrome100.0.4896.127 1 1 chrome133.0.0.0 1 1 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 4 Hello_from_Palo_Alto_Networks,_find_out_more_about_our_scans_in_https://docs-cortex.paloaltonetworks.com/r/1/Cortex-Xpanse/Scanning-activity 20251128032229 Mozilla/5.0 20251101162551 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20251128220101 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20251116170254 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Hello_from_Palo_Alto_Networks,_find_out_more_about_our_scans_in_https://docs-cortex.paloaltonetworks.com/r/1/Cortex-Xpanse/Scanning-activity 20251128032229 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 68 68 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 2 404 218 0 421 2 644 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 123 /saas/.env 1 - /.env.development 1 - /new/.env.production 1 - /_profiler/phpinfo 2 - /settings.json 1 - /gcp-credentials.json 1 - /kubernetes/.env 1 - /.api_keys 1 - /mailer/.env 1 - /aws-secret.yaml 3 - /vendor/.env 1 - /secrets.json 1 - /.git/config 20 - /mail/.env 1 - /administrator/.env 1 - /config/app.yml 1 - /new/.env 1 - /xampp/.env 1 - /config.yml 1 - /vendor/phpunit/phpunit/src/Util/PHP/eval-stdin.php 2 - /public/_ignition/execute-solution 2 - /core/Datavase/.env 1 - /_ignition/execute-solution 2 - /app.config 1 - /laravel/info.php 2 - /config.env 1 - /admin/.env 2 - /.env.staging 1 - /docker/.env 2 - /config/.env 1 - /.gitignore 2 - /database/.env 1 - /settings.yml 1 - /config.json 1 - /cronlab/.env 1 - /.git/credentials 2 - /psnlink/.env 1 - /env/.env 1 - /config.yaml 1 - /www/.env 1 - /.aws/credentials 1 - /laravel/.env 2 - /uploads/.env 1 - /prod/.env 1 - /main/.env 1 - /web.config 1 - /.s3cfg 1 - /conf/.env 1 - /.env.remote 1 - /_debug 1 - /.vscode/.env 1 - /.aws/config 1 - /js/.env 1 - /.env.sample 1 - /xampp/phpinfo.php 1 - /_phpinfo.php 1 - /awstats/.env 1 - /_profiler/phpinfo/info.php 1 - /public/.env 2 - /config.php 1 - /en/.env 1 - /v1/.env 1 - /tools/.env 1 - /config/config.yml 1 - /core/.env 1 - /app_dev.php/_profiler/open 1 - /lara/info.php 1 - /phpinfo 1 - /configuration.json 1 - /node_modules/.env 1 - /.env.production 1 - /assets/.env 1 - /public/vendor/laravel-filemanager/js/script.js 2 - /config/database.yml 1 - /api/shared/config.env 1 - /api/shared/config/config.env 1 - / 2 - /sitemaps/.env 1 - /api/.env 2 - /new/.env.staging 1 - /site/.env 2 - /application.properties 1 - /.env.local 1 - /portal/.env 1 - /app/.env 3 - /_profiler/phpinfo/phpinfo.php 1 - /.env 13 - /.env.test 1 - /.env.save 1 - /website/.env 1 - /robots.txt 39 - /apps/.env 1 - /.well-known/security.txt 3 - /lab/.env 1 - /.config 1 - /application.yml 1 - /nginx/.env 1 - /kubernetes.yml 1 - /.env.old 1 - /geoserver/web/wicket/bookmarkable/org.geoserver.web.demo.MapPreviewPage 2 - /aws.json 1 - /core/app/.env 1 - /env.backup 1 - /.env.bak 1 - /wp-config 2 - /v2/.env 1 - /docker/app/.env 1 - /web/.env 1 - /exapi/.env 1 - /new/.env.local 1 - /lib/.env 1 - /phpinfo.php 2 - /.env.example 1 - /.env.backup 1 - /cron/.env 2 - /dev/.env 1 - /laravel/core/.env 1 - /vendor/laravel-filemanager/js/script.js 2 - /kyc/.env 1 - /lara/phpinfo.php 1 - /development/.env 1 - /azure.json 1 - /.gcloud/credentials 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 44 45.148.10.174 9 9 4023 20251118094341 115.231.78.8 4 4 1788 20251118201755 64.227.153.163 3 3 894 20251115130312 68.183.182.170 3 3 894 20251118035534 204.76.203.25 3 3 1341 20251120040432 3.85.47.180 2 2 894 20251129203217 195.211.77.142 2 2 447 20251106143345 149.50.97.212 2 2 894 20251110222403 206.168.34.122 2 2 894 20251109160623 66.132.153.137 2 2 894 20251116170254 176.65.132.20 2 2 894 20251104044256 167.94.146.56 2 2 894 20251114222238 185.247.137.169 1 1 447 20251128220101 52.88.127.223 1 1 447 20251124123722 44.255.216.87 1 1 447 20251129081116 185.247.137.48 1 1 447 20251126230820 35.90.242.96 1 1 447 20251118033424 34.214.2.134 1 1 447 20251109211030 35.170.13.97 1 1 447 20251121222227 3.138.185.30 1 1 447 20251125062415 165.227.71.109 1 1 447 20251110073819 18.141.225.240 1 1 447 20251101162551 205.210.31.28 1 1 447 20251108014223 184.73.189.76 1 1 447 20251125143728 54.212.190.58 1 1 447 20251126111902 161.35.119.251 1 1 447 20251124010843 35.88.161.65 1 1 447 20251105010048 196.251.88.64 1 1 447 20251101000756 100.26.106.40 1 1 447 20251130045314 18.246.32.68 1 1 447 20251127110301 159.203.10.144 1 1 447 20251119025808 198.235.24.98 1 1 447 20251128032229 147.185.132.48 1 1 447 20251118033217 35.164.214.44 1 1 447 20251130071028 128.199.53.91 1 1 447 20251101025127 44.249.27.63 1 1 447 20251125120155 3.92.143.245 1 1 447 20251130144712 54.165.196.254 1 1 447 20251129223529 194.164.107.6 1 1 447 20251125210540 205.210.31.84 1 1 447 20251122141616 34.222.22.199 1 1 447 20251128113030 18.224.192.118 1 1 447 20251117153018 104.248.32.14 1 1 447 20251105054144 205.210.31.94 1 1 447 20251104190908 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 23 20251101 3 3 1341 3 20251104 3 3 1341 2 20251105 3 3 1341 3 20251106 2 2 447 1 20251108 1 1 447 1 20251109 3 3 1341 2 20251110 3 3 1341 2 20251114 2 2 894 1 20251115 3 3 894 1 20251116 2 2 894 1 20251117 1 1 447 1 20251118 18 18 7599 6 20251119 2 2 894 2 20251120 1 1 447 1 20251121 1 1 447 1 20251122 1 1 447 1 20251124 2 2 894 2 20251125 4 4 1788 4 20251126 2 2 894 2 20251127 1 1 447 1 20251128 3 3 1341 3 20251129 4 4 1788 4 20251130 3 3 1341 3 END_DAY # Session range - Number of visits BEGIN_SESSION 2 0s-30s 46 30s-2mn 2 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 68 29055 48 48 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 2 100-500 210 0-44 237 END_FILESIZE # Request Time Range - Request Time Frequency BEGIN_REQUESTTIME 0 END_REQUESTTIME