AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202312 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2717 POS_VISITOR 8924 POS_DAY 10782 POS_DOMAIN 3427 POS_LOGIN 3775 POS_ROBOT 3930 POS_WORMS 4349 POS_EMAILSENDER 4480 POS_EMAILRECEIVER 4623 POS_SESSION 11298 POS_SIDER 11504 POS_FILETYPES 4758 POS_DOWNLOADS 5013 POS_OS 5061 POS_BROWSER 5316 POS_SCREENSIZE 5903 POS_UNKNOWNREFERER 5977 POS_UNKNOWNREFERERBROWSER 6677 POS_ORIGIN 7286 POS_SEREFERRALS 7423 POS_PAGEREFS 7567 POS_SEARCHWORDS 7715 POS_KEYWORDS 7867 POS_MISC 2380 POS_ERRORS 7926 POS_CLUSTER 3631 POS_SIDER_404 8061 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240101104216 1 0 8584005554436 FirstTime 20231201212131 LastTime 20231230201241 LastUpdate 20240101181208 1 0 0 0 0 TotalVisits 74 TotalUnique 44 MonthHostsKnown 0 MonthHostsUnknown 44 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 WindowsMediaPlayerSupport 0 0 0 JavaEnabled 0 0 0 TotalMisc 0 0 0 FlashSupport 0 0 0 DirectorSupport 0 0 0 AddToFavourites 0 22 0 QuickTimeSupport 0 0 0 JavascriptDisabled 0 0 0 RealPlayerSupport 0 0 0 PDFSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 4 4 21 0 0 0 1 0 0 0 2 2 390270 2 3 3 372168 31 31 763946 3 35 111 4607281 91 98 2352091 4 22 22 249838 4 345 308741 5 2 2 372168 29 29 930716 6 8 8 165350 4 142 529578 7 10 68 1182643 1 1 226 8 6 7 178185 4 74 780872 9 15 16 543779 4 8 432748 10 6 6 82670 0 68 56262 11 4 4 472950 1 1 226 12 0 0 0 0 0 0 13 3 3 390270 29 29 391778 14 10 86 2382666 0 5 415 15 34 128 5893737 6 14 195974 16 51 308 15846787 0 6 0 17 3 3 65284 0 0 0 18 2 2 91390 0 0 0 19 13 13 174054 0 221 226492 20 39 200 9387317 0 138 112061 21 4 4 167158 2 2 377942 22 8 8 365584 0 0 0 23 6 6 84478 2 172 221945 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 9 us 179 552 18242615 in 60 409 21051655 ca 28 28 3011740 ru 11 12 334823 au 2 2 91396 jp 2 2 82680 vn 2 2 82680 nl 2 2 91390 cz 2 3 86799 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 7 no_user_agent 26 4987994 20231231064455 0 Go\-http\-client/ 24 7692 20231224134321 0 scanner 5 169479 20231208043823 0 unknown 4 520 20231208094103 4 bot[\s_+:,\.\;\/\\-] 2 84478 20231204154654 0 (firefox/)([0-9]\.|[0-1][0]\.) 2 82680 20231208231055 0 validator 2 82680 20231208065453 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 10 ttf 4 673568 0 0 js 348 3359269 0 0 woff2 27 1463828 0 0 png 61 6434406 0 0 woff 15 381932 0 0 jpg 59 18944938 0 0 php 73 21 0 0 html 169 10045914 0 0 webp 14 120336 0 0 css 242 1651566 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 13 Unknown 127 125 win10 505 69 linux 13 13 macosx13 2 2 android10 104 18 androidmarshmallow 10 10 macosx6 4 4 macosx15 3 3 ios_ipad 2 2 androidpie 2 2 ios_iphone 2 2 win7 35 4 android 203 34 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 26 chrome110.0.0.0 6 4 chrome79.0.3945.79 55 10 chrome109.0.0.0 83 6 Unknown 121 121 chrome84.0.4147.105 62 4 chrome96.0.4664.110 2 2 chrome83.0.4103.61 31 0 safari4.0.4 2 2 chrome116.0.0.0 7 7 chrome52.0.3624.98 10 10 chrome117.0.5938.132 78 4 safari 2 2 chrome96.0.4664.45 2 2 chrome115.0.0.0 197 28 chrome120.0.0.0 210 30 chrome108.0.0.0 19 19 chrome87.0.4280.141 100 14 opera11.52 2 2 firefox60.0 2 2 mozilla 6 4 chrome101.0.4951.41 2 2 chrome41.0.2228.0 2 2 opera11.01 2 2 safari3.1.1 2 2 chrome117.0.0.0 3 3 chrome103.0.5060.114 4 4 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 6 Python/3.9_aiohttp/3.9.1 20231208033826 WordPress/6.4.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231229170420 WhatsApp/2.23.20.0 20231229162712 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20231230200056 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20231229095852 WordPress/6.4.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231207005120 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 5 WhatsApp/2.23.20.0 20231229162712 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20231230200056 WordPress/6.4.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231229170420 Python/3.9_aiohttp/3.9.1 20231208033826 WordPress/6.4.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231207005120 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 208 234 From1 0 0 From2 0 0 From3 0 0 From4 80 778 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 409 46 3818 405 4 168 301 1149 0 406 9 2034 404 91 2650740 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 14 /_all_dbs 6 - /Public/home/js/check.js 2 https://www.testsahyadrimahavidyalay.ptechinstitute.com/Public/home/js/check.js /.vscode/sftp.json 3 - /v2/_catalog 6 - /telescope/requests 6 - /wp-emoji-release.min.js 25 - /s/730323e2834323e20313e2631323/_/ 6 - /.DS_Store 6 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 6 - /static/admin/javascript/hetong.js 2 https://www.testsahyadrimahavidyalay.ptechinstitute.com/static/admin/javascript/hetong.js /.git/config 8 - /config.json 3 - /debug/default/view 6 - /login.action 6 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 44 216.10.248.154 105 105 1392565 20231229170420 103.176.135.79 37 216 10769402 20231229162712 152.57.61.30 14 100 5013881 20231229163534 106.200.100.4 12 96 4939378 20231230201241 106.220.131.17 11 97 5342875 20231229170419 205.169.39.197 10 86 2382666 20231208143505 195.211.77.142 8 8 248024 20231215074739 52.53.184.182 6 6 256724 20231215195056 152.57.123.225 6 83 3461557 20231219204423 104.234.204.32 6 6 248010 20231211085447 47.242.224.70 4 4 165360 20231208211205 65.154.226.169 4 78 2264831 20231208035123 35.217.53.246 4 62 709709 20231210072104 144.126.198.24 4 4 762438 20231224134306 65.21.65.198 2 2 82680 20231208033826 139.144.150.45 2 2 372168 20231212054756 47.251.14.232 2 2 82680 20231208154237 54.153.65.195 2 2 84478 20231205040403 47.254.25.10 2 2 82680 20231208154237 171.244.43.14 2 2 82680 20231208094106 46.101.9.27 2 2 91390 20231219180841 133.242.174.119 2 2 82680 20231208063644 199.45.155.19 2 3 95515 20231228081535 205.210.31.88 2 2 390270 20231216113632 205.210.31.216 2 2 390270 20231230200056 154.28.229.50 1 1 41340 20231208033735 104.164.173.58 1 1 41340 20231208153715 154.28.229.143 2 2 82680 20231208153703 13.52.184.181 2 2 82680 20231209043910 159.89.90.17 2 2 91390 20231215200453 159.203.41.26 2 2 84478 20231205230742 198.235.24.83 2 2 390270 20231229035835 104.164.173.130 2 2 82680 20231208033719 205.210.31.75 2 2 390270 20231223164135 195.211.77.140 1 1 0 20231208033724 165.22.74.203 2 2 390270 20231224030803 139.59.153.118 2 2 91396 20231229202428 198.235.24.44 2 2 390270 20231219074541 137.184.220.134 2 2 84478 20231201212131 198.235.24.143 2 2 390270 20231224035950 199.45.155.32 2 3 95515 20231229095842 185.209.196.148 2 3 86799 20231208033712 144.126.202.105 2 2 377942 20231208033619 178.249.209.187 2 3 86799 20231208033716 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 20 20231201 2 2 84478 1 20231203 1 1 0 1 20231205 12 12 168956 3 20231207 3 3 21 1 20231208 69 221 6521917 23 20231209 14 14 165350 5 20231210 5 63 709709 2 20231211 7 7 165340 4 20231212 5 5 744336 3 20231214 14 14 413326 2 20231215 18 18 348108 4 20231216 2 2 390270 1 20231219 11 88 3943217 4 20231220 24 118 5604357 2 20231222 8 8 365584 1 20231223 2 2 390270 1 20231224 7 7 1170810 4 20231228 3 4 95515 2 20231229 67 325 16464566 8 20231230 14 98 5329648 2 END_DAY # Session range - Number of visits BEGIN_SESSION 7 0s-30s 58 1h+ 1 5mn-15mn 4 30mn-1h 3 15mn-30mn 1 30s-2mn 4 2mn-5mn 3 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 29 / 131 8814742 50 43 /wp-cron.php 72 0 21 22 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.woff2 8 625568 1 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsjZ0B4gaVQUwaEQXjM.woff 8 138360 1 1 /wp-content/fonts/lato/S6u9w4BMUTPHh6UVSwiPGQ.woff2 8 184320 0 1 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.woff2 8 614112 0 0 /admission/ 6 195834 0 0 /wp-content/fonts/poppins/pxiByp8kv8JHgFVrLGT9Z1xlE92JQEk.woff 5 51860 0 1 /alumni/ 4 130208 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-regular-400.woff2 3 39828 0 0 /staff-list/ 2 65166 0 0 /alumni-2/ 2 65184 0 0 /iqac-committee/ 2 65284 0 1 /student-satisfaction-survey/ 2 65318 0 0 /social-media/ 2 65182 0 0 /women-development-cell/ 2 65918 0 0 /statutory-committee/ 2 65246 0 1 /about/ 2 68314 0 1 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.ttf 2 268080 0 0 /chairmans-message/ 2 66788 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.ttf 2 405488 0 1 /principle-message/ 2 66716 0 0 /procedures-and-polices-for-maintaining-and-utilizing-physical-academic-and-support-facilities/ 2 56894 0 1 /about-collage/ 2 66584 0 0 /notices-announcement/ 2 56670 1 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.woff 1 101652 0 0 /wp-admin/upgrade.php 1 21 0 1 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.woff 1 90060 0 0 /department-of-english/ 2 65866 0 0 END_SIDER