AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202412 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2699 POS_VISITOR 6750 POS_DAY 6899 POS_DOMAIN 3302 POS_LOGIN 3528 POS_ROBOT 3683 POS_WORMS 4009 POS_EMAILSENDER 4140 POS_EMAILRECEIVER 4283 POS_SESSION 6978 POS_SIDER 7124 POS_FILETYPES 4418 POS_DOWNLOADS 4515 POS_OS 4687 POS_BROWSER 4766 POS_SCREENSIZE 4830 POS_UNKNOWNREFERER 4904 POS_UNKNOWNREFERERBROWSER 5109 POS_ORIGIN 5309 POS_SEREFERRALS 5441 POS_PAGEREFS 5585 POS_SEARCHWORDS 5733 POS_KEYWORDS 5885 POS_MISC 2363 POS_ERRORS 5944 POS_CLUSTER 3384 POS_SIDER_404 6068 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250102012437 1 0 8241824724931 FirstTime 0 LastTime 20241219223109 LastUpdate 20250102184459 1 0 0 0 0 TotalVisits 2 TotalUnique 2 MonthHostsKnown 0 MonthHostsUnknown 2 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 AddToFavourites 0 4 0 FlashSupport 0 0 0 PDFSupport 0 0 0 TotalMisc 0 0 0 JavascriptDisabled 0 0 0 RealPlayerSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 JavaEnabled 0 0 0 DirectorSupport 0 0 0 QuickTimeSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 0 0 0 8 12 3274617 2 0 0 0 39 39 519384 3 0 0 0 40 42 445180 4 0 0 0 74 78 890500 5 0 0 0 41 41 479811 6 12 12 6578 12 12 120 7 0 0 0 41 43 479501 8 0 0 0 8 12 36972 9 0 0 0 79 79 925125 10 0 0 0 110 110 1340583 11 0 0 0 8 10 672 12 0 0 0 4 9 1869209 13 0 0 0 43 43 469026 14 0 0 0 39 39 434365 15 0 0 0 0 0 0 16 0 0 0 2 2 0 17 0 0 0 6 6 26237 18 0 0 0 33 33 408128 19 0 0 0 4 4 36952 20 0 0 0 2 2 0 21 0 0 0 2 4 36952 22 9 9 14272 41 43 545571 23 0 0 0 6 6 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 1 us 21 21 20850 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 5 Go\-http\-client/ 60 18750 20241231023947 0 bot[\s_+:,\.\;\/\\-] 6 3237665 20241231010344 2 Googlebot/ 4 440 20241210111625 4 Applebot/ 3 1832257 20241224125946 2 unknown 2 220 20241226043758 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 html 15 19358 0 0 php 6 1492 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 2 /wp-content/uploads/2024/02/migrationform.pdf 2 0 3664074 /wp-content/uploads/2024/02/B.Ed-Syllabus-2017-18.pdf 1 0 1364622 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 Unknown 21 21 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 1 Unknown 21 21 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Jetpack_by_WordPress.com 20241219223109 WordPress.com;_https://adhyapakmahavidyalay.ptechinstitute.com 20241219062629 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 2 Jetpack_by_WordPress.com 20241219223109 WordPress.com;_https://adhyapakmahavidyalay.ptechinstitute.com 20241219062629 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 0 From1 0 0 From2 0 0 From3 0 0 From4 21 21 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 406 19 4294 404 390 7125159 405 2 120 301 179 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 16 /actuator/env 12 - /config.json 15 - /server 30 - /telescope/requests 30 - /.vscode/sftp.json 15 - /debug/default/view 30 - /v2/_catalog 30 - /_all_dbs 30 - /ads.txt 10 - /login.action 30 - /info.php 28 - /.git/config 38 - /.git/ 2 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 30 - /s/730323e2834323e20313e2631323/_/ 30 - /.DS_Store 30 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 2 192.0.86.189 12 12 6578 20241219062646 192.0.86.160 9 9 14272 20241219223109 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 1 20241219 21 21 20850 2 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 2 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 2 / 15 19358 1 2 /xmlrpc.php 6 1492 1 0 END_SIDER