AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202412 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2692 POS_VISITOR 7855 POS_DAY 8261 POS_DOMAIN 3430 POS_LOGIN 3702 POS_ROBOT 3857 POS_WORMS 4274 POS_EMAILSENDER 4405 POS_EMAILRECEIVER 4548 POS_SESSION 8540 POS_SIDER 8677 POS_FILETYPES 4683 POS_DOWNLOADS 4766 POS_OS 5621 POS_BROWSER 5773 POS_SCREENSIZE 5980 POS_UNKNOWNREFERER 6054 POS_UNKNOWNREFERERBROWSER 6267 POS_ORIGIN 6349 POS_SEREFERRALS 6481 POS_PAGEREFS 6644 POS_SEARCHWORDS 6792 POS_KEYWORDS 6944 POS_MISC 2355 POS_ERRORS 7003 POS_CLUSTER 3558 POS_SIDER_404 7119 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250101005149 1 0 11846763382932 FirstTime 0 LastTime 0 LastUpdate 20250101182848 1 0 0 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 13 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 QuickTimeSupport 0 0 0 PDFSupport 0 0 0 JavascriptDisabled 0 0 0 AddToFavourites 0 16 0 FlashSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 DirectorSupport 0 0 0 RealPlayerSupport 0 0 0 TotalMisc 0 0 0 JavaEnabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 2 114086 6 24 1349245 1 0 1 166285 37 44 1064080 2 0 1 42015 39 47 2597112 3 0 1 897689 78 89 2958636 4 0 0 0 41 51 1339162 5 0 0 0 43 54 2886325 6 0 1 166285 47 65 2702828 7 0 0 0 2 20 3209331 8 0 0 0 16 28 487207 9 0 0 0 77 97 6995873 10 0 0 0 8 31 639731 11 0 9 1828513 114 126 3140545 12 0 4 2859352 78 96 2977208 13 0 2 1063974 5 20 1258974 14 0 0 0 105 121 4963159 15 0 0 0 155 177 6964585 16 0 0 0 42 65 3029204 17 0 0 0 53 67 1621607 18 0 1 77381 64 73 2419696 19 0 5 2007274 144 181 17472571 20 0 2 136646 12 27 5510394 21 0 0 0 10 21 667248 22 0 1 282406 10 26 1539512 23 0 1 166285 41 53 2152132 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 4 jp 0 2 1795378 cn 0 1 897689 us 0 14 4099645 in 0 14 3015479 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 7 Googlebot/ 184 17010624 20241230162927 94 Go\-http\-client/ 120 39240 20241231021641 0 bot[\s_+:,\.\;\/\\-] 52 7281319 20241223205611 12 facebookexternalhit/ 30 23340426 20241228074756 4 bingbot/ 28 809268 20241218005206 12 unknown 8 984 20241218170740 8 crawl 2 1456 20241224163759 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 pdf 31 9808191 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 12 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 46 0 41293694 /wp-content/uploads/2024/01/Tejasvi-Bhandari-madam-FACULTY-PROFILE.pdf 21 0 3491985 /wp-content/uploads/2024/01/Academic-Calender-2021-22.pdf 16 0 1153136 /wp-content/uploads/2024/01/Academic-Calender-2019-20.pdf 15 0 1070895 /wp-content/uploads/2024/01/Academic-Calender-2022-23.pdf 15 0 1160715 /wp-content/uploads/2024/01/Academic-Calender-2018-19.pdf 14 0 913542 /sitemap.xml.gz 14 0 3458 /wp-content/uploads/2024/01/Academic-Calender-2020-21.pdf 14 0 874216 /wp-content/uploads/2024/01/Department-of-English-CO.pdf 14 0 5630338 /wp-content/uploads/2024/01/Faculty-Profile.pdf 9 0 378135 /wp-content/uploads/2024/01/Kadam-P.A.pdf 5 0 1412030 /wp-content/uploads/2024/02/Marathi-Dr-Dipti-Shembekar-FACULTY-PROFILE.pdf 4 0 675828 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 6 ios_iphone 3 0 androidmarshmallow 9 0 android 1 0 win10 5 0 Unknown 2 0 android10 11 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 7 chrome125.0.6422.142 1 0 safari13.0.3 3 0 chrome131.0.6778.108 3 0 chrome131.0.6778.69 4 0 chrome131.0.0.0 15 0 chrome129.0.0.0 1 0 chrome131.0.6778.139 4 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 1 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/131.0.6778.69_Safari/537.36 20241208123550 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 14 From1 0 0 From2 0 1 From3 0 0 From4 0 16 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 1 www_google_com 0 1 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 3 301 306 0 404 775 31444516 406 82 18532 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 19 /actuator/env 24 - /.git/HEAD 2 - /sitemap.xml.gz 10 - /wp-admin.php 1 - /.vscode/sftp.json 30 - /login.action 60 - /.DS_Store 64 - /_all_dbs 60 - /info.php 50 - /ads.txt 10 - /server 60 - /telescope/requests 60 - /v2/_catalog 60 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 60 - /debug/default/view 58 - /s/730323e2834323e20313e2631323/_/ 60 - /config.json 30 - /.git/ 2 - /.git/config 74 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 13 66.249.79.37 0 1 282406 171.76.86.12 0 4 659663 40.80.158.10 0 1 897689 152.58.7.140 0 2 136646 183.87.211.38 0 9 1458127 66.249.68.37 0 5 582885 43.130.74.193 0 1 897689 66.249.68.38 0 3 1230259 66.249.68.36 0 1 897689 103.178.209.7 0 1 897689 43.135.182.95 0 1 897689 124.156.157.91 0 1 897689 66.249.79.162 0 1 72071 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 10 20241202 0 3 1961663 0 20241206 0 7 2143920 0 20241207 0 1 77381 0 20241208 0 5 437446 0 20241218 0 2 332570 0 20241219 0 2 939704 0 20241223 0 4 2003678 0 20241226 0 2 1180095 0 20241228 0 1 72071 0 20241229 0 4 659663 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER